(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE184

MICSR_1.PE184        Location/Qualifiers
FT   CDS_pept        complement(364807..365370)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636524"
FT                   /orf_name="MICPUN_107882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62114.1"
FT                   /db_xref="UniParc:UPI000199A984"
FT                   /db_xref="UniProtKB/TrEMBL:C1E161"
FT                   /transl_table=1
FT                   /translation="MRNKGRSRRLAAAANSADAASAEATSPTSPGAGADDDEVRQPFAA
FT                   SDRVGSRAGSGAGTGPSDADTTSGDVRLNMFASSEHVGGEGDEGFRGDGATTPVEARGV
FT                   ETLAVLDEQQLWAMGLLGDEQIETKNMSREGSAHSEIGYEPAAWVDSETCQLVPELRNE
FT                   LLELMHQKRARSTEPEDVDDYLVL"
     atgcgcaaca agggcaggag caggcggctc gcggcggcgg ccaactcggc cgacgcggca        60
     tccgccgagg ccacctctcc cacgtctccc ggcgcgggcg cggatgacga cgaggtgagg       120
     cagccgttcg cggcgagcga tcgggtgggg tcccgcgcgg ggtccggggc gggcacgggc       180
     ccgtcggacg ccgacacgac gagcggcgac gttcgtctga acatgttcgc gtcgtctgaa       240
     catgtggggg gggaaggcga cgaggggttc aggggcgacg gcgcgacgac gccggtggag       300
     gcgcgcgggg tggagacgct cgccgtgctc gacgagcaac agctgtgggc gatgggtttg       360
     ctcggggacg agcagattga gacgaagaac atgtcgcgcg aggggtcggc gcacagcgag       420
     attgggtacg agcccgcggc gtgggtggat agcgagacct gccagctggt gccggagctc       480
     aggaacgagc tcctggagct gatgcatcaa aagcgggcga ggtcgacaga gccggaggac       540
     gtggacgact acttggtgct ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page