(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE186

MICSR_1.PE186        Location/Qualifiers
FT   CDS_pept        complement(371270..373858)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636526"
FT                   /orf_name="MICPUN_56759"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62115.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199A986"
FT                   /db_xref="UniProtKB/TrEMBL:C1E163"
FT                   /transl_table=1
FT                   /translation="MPNTRKTEVIKQEANGTAGDVASVKKVDSVTNLLSPLPSIEKVAS
FT                   FGLTPNPSGNPPLNPAVNAMKKSGSGLATSASPSADAAGAGGRPVDSGVTSSGATGSDA
FT                   NALGSGFRPIKRSRRSSENHDKDVNVRDFEGVDLAGISRRFPQEKRVQLAQRIDEHAEK
FT                   VAGAWAALLLAQTGMRYAEWATTASRVEQTKQNTLRIVKAIVDYLTTASQAKLRQTISY
FT                   IVAKRRRQGFGHEEVITSMLLLRRSFEKGCGPIDGEAGFLIDAVTRVMVGEVATYLHAI
FT                   NPHEESQLDVCVATEDDDELGVEHPEDLNLPPQRHLQQDLEDVRPPMHLFIVPKVPAQY
FT                   VRAREGGTPIMLAPLWSRAAHEPSGLWTWPRGTEPLVGAIVNNRFVVEAYIASGSYGHG
FT                   WKAVDLHSKKPVFLKTPRASHDYMPSDMMGELARELGTMRRILHTIPKHPRLVNVIEVT
FT                   PPHAPKPCATSCGVTAPIHYFACDLCEGGDLFGYISTQPLEPMREPVVAHIFRQLMEAL
FT                   EFLHGRNLFHRDLKTENMLVSREEGRYSLKVADFGRTVFVPPQPSETGEGPTNIHEQFS
FT                   YDNGIFPAEAVRGGMIGDEVMAAEDGMYRLPSADVWAAGLVLLLLTGVGRMSKIKHNIA
FT                   DALRGRGERFAPLSKDETPIDRLYRLIGPGWQVSPELDQLFRAMVHKDPMMRPSAEEVL
FT                   ACDWMKKADEVTEAEVVAAFESRRPVSEEAHNTMSVTCAPRLKDTATAFDALIEALQSL
FT                   EWPTAGNDVRAEVHVDRDRLTATCVMDEMRIRAILTPVEGLLEKNPTVNMFKEGEGEAD
FT                   PVAAAKRMEAARRERENNQTPIVRLVWIGGSAGAMQLVNVYMAVSAMLST"
     atgcccaaca cacgcaagac ggaggtgatc aagcaggagg ccaacgggac cgcgggcgac        60
     gtcgcctcgg tcaagaaggt cgactcggtg acgaacctgc tgagcccgct gccgagcatc       120
     gagaaggttg cgtcgttcgg gctgaccccg aacccgagcg ggaacccccc gctcaatccc       180
     gcggtgaacg ccatgaagaa gagcggaagc ggcctcgcca cgagcgcatc cccgtcggcg       240
     gacgcggccg gcgcgggcgg caggccggtc gacagcggcg tcacgtcgtc cggcgcgacc       300
     ggctcggacg ccaacgcgct cggctcggga ttcaggccaa tcaagcgctc ccgccgcagc       360
     tccgagaacc acgacaagga cgtcaacgtg cgggatttcg agggcgtcga cctcgcgggt       420
     atctctcgca gattcccgca ggagaagcgc gtccagctgg cgcagaggat cgacgaacac       480
     gccgagaagg tggcgggcgc ttgggcggcg ctgctgctcg cgcagaccgg catgagatac       540
     gcggagtggg cgaccaccgc ctctcgggtc gagcagacga agcagaacac cctgcggatc       600
     gtcaaggcca tcgtggatta cctcaccacc gcatcgcagg ccaagctgag gcagacgatc       660
     tcctacatcg tcgccaagcg ccggcggcag ggcttcgggc acgaggaggt gatcacgtcg       720
     atgctcctcc tgcggcggtc gttcgagaag ggttgcgggc cgatcgacgg cgaggccggg       780
     ttcctcatcg acgccgtcac gcgcgtcatg gtcggcgagg tcgccaccta cctccacgcc       840
     atcaacccgc acgaggagag ccagctcgac gtatgcgtcg ccaccgagga cgacgacgag       900
     ctcggcgtgg agcacccgga ggacctcaac ctccccccgc agcgacacct gcagcaggac       960
     ctcgaggacg tcaggccgcc catgcacctg ttcatcgttc ccaaggttcc cgcgcagtac      1020
     gttcgcgcca gggagggcgg cacgcccatc atgctcgccc cgctgtggtc gagagccgcg      1080
     cacgagccct cgggtctgtg gacgtggccg aggggcaccg agccgctcgt gggcgccatc      1140
     gtgaacaaca ggttcgtcgt cgaggcgtac atcgcgtcag ggtcgtacgg tcacgggtgg      1200
     aaggcggtgg acctgcacag caagaaaccg gtcttcctca agacgccgag agcgtcgcac      1260
     gattacatgc cgagcgacat gatgggcgaa ctcgcgaggg agctcggcac catgcgacgc      1320
     atcctgcaca ccatccccaa gcacccgcgg ctcgtcaacg tcatcgaggt gaccccgccg      1380
     cacgccccta agccatgcgc gacgtcgtgc ggcgtcaccg cgcccatcca ctacttcgcg      1440
     tgcgacctgt gcgagggagg cgacctcttc gggtacatct cgacgcagcc gctggagccg      1500
     atgcgagagc ccgtggtggc gcacatcttc cggcagctga tggaggcgct cgagtttctc      1560
     cacgggcgaa acctgttcca ccgcgacctc aagacggaaa atatgctggt gtctagggag      1620
     gaggggaggt actcgctcaa agttgcggat tttggccgca ccgtctttgt gccaccgcag      1680
     ccctcggaga ctggcgaggg acccaccaac atccacgagc agttctcata cgacaacggc      1740
     atcttccccg ccgaggctgt gcgggggggc atgatcggcg acgaggtgat ggccgcggaa      1800
     gacggcatgt accgccttcc ctcggcggac gtgtgggccg cgggcctggt cctcctgctc      1860
     ctcaccggcg tcgggaggat gtccaagatt aagcacaaca tcgccgacgc gctgcgaggc      1920
     cgcggcgaga gattcgcgcc gttgtccaag gacgagaccc cgatcgaccg gctctaccgg      1980
     ctcatcggac ccgggtggca ggtctccccc gagctggacc agctcttcag ggcgatggtt      2040
     cacaaggacc cgatgatgcg accgagcgcc gaggaggttc tcgcgtgcga ttggatgaaa      2100
     aaagcggacg aggtgaccga ggcggaggtt gtcgccgcgt tcgagagcag gcggccagtg      2160
     agcgaggagg cccacaacac catgtcggtg acgtgcgcgc cccggctcaa ggacaccgcg      2220
     accgcattcg acgccctcat agaggcgctt cagtcgttgg agtggccgac ggcggggaac      2280
     gacgttcgcg ccgaggttca cgtcgatcgc gaccggctca ccgcgacgtg cgtgatggac      2340
     gagatgcgaa tccgcgcgat attaaccccc gtcgagggtc tgctcgagaa gaaccccacg      2400
     gtgaacatgt tcaaggaggg ggagggggag gcggacccgg tggccgcggc gaagcggatg      2460
     gaggcggcga ggcgcgagag ggagaacaac cagacgccga ttgtgcggct ggtttggatc      2520
     gggggcagcg cgggggccat gcagctggtc aacgtgtaca tggcggtgtc cgccatgctg      2580
     agcacatag                                                              2589
//

If you have problems or comments...

PBIL Back to PBIL home page