(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE188

MICSR_1.PE188        Location/Qualifiers
FT   CDS_pept        join(complement(380306..380458),complement(377344..380199))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636528"
FT                   /orf_name="MICPUN_56761"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62116.1"
FT                   /db_xref="UniParc:UPI000199A9EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E165"
FT                   /transl_table=1
FT                   /translation="MGSEGAGAPPAPLRPEECLDLDLWDHIFDDAAVAKRSPLRTLARD
FT                   MRAQLEIAEKALPRTAERDALLAKLEDIAEAASRDVTLLVADWRGIEGSVVADDDETNG
FT                   TPAGKGLEHLPLQEGLPPGVNVVTRVGTVTRAALADADALALILDEHQAASAEETTTPS
FT                   VAAPYSSDAPRADETPEREEGSRQTPASSTDEGAIEGEAREGEGDDAAVTTVTTAGADA
FT                   AQLARECVKRAGEFSVFIAVEADQRPPELRFDRAAGPPTADQPEEPETPPPLDAAAAEG
FT                   SGEGHSGAGDEEPGANPLESFEAFGSWFNKMVETAADQFTGNNDDDGSSDDDGEDLSDG
FT                   GDAAAGMVKSSGPKSPEKKPAAKREKRDSESERKERERKEREAEALRRYKPKRPRDAAN
FT                   GLAARCGVRAGRILSVATMHLVPPPGGFARTAGGAAEGTAGGDDDSDAGPDGDGSKPLQ
FT                   REGGEGETEAEKAERERNAAERARAMSELYRKMMDEQDRGEGPSDDGDKTDGGDDRTGG
FT                   EGGDLTNYVDDAEIEAMLGETEAANNWSKVTDREYAWVKAVGKTCQAIMVEKTLGLIER
FT                   YAPLRAYVRYWAAVVRADETLSNHADAAEQAKAVAANTLGRILTSAAEGMPNVGFVGAA
FT                   ELAALHRRRDPSISAGWLKALIYGDSTMSFTGGTILSLGGPAAAPVTAPPALAMYFTIR
FT                   LRLCLAIAALGGCDVLGPEAGAATLACFFGTDARELLDARPRVEELDALIAAANDAAAG
FT                   GADGGNGPGRSSSWLPDVSGAMSRVFKAGASAQRVAQRCAAGYAARASAHVARRAAMGR
FT                   ETFQSGTGDVDADCTRAYEVAYQRALPREMVRAMGEHVFTAANMVVVAAELVPFVSSYL
FT                   TVRAANAAIKCHLPHLAPAAEAELENAKDSADANAAAATPSGGWTKDITDGASKVANSV
FT                   GAAASEAAARTSAAAAAAGAGIASLWSKASETAASSIKVTGLVREGGTEPVPRLSDPDA
FT                   LRTFVSTGSGGVV"
     atgggctccg agggggcggg ggccccgccg gcgcctctgc gaccggagga gtgcctcgac        60
     ttggacctgt gggatcacat cttcgacgat gcggccgtcg ctaagcgctc gccgctacgg       120
     accctcgcgc gggacatgcg cgcgcagctc gagatcgcag agaaagcact gccgaggacc       180
     gcggagcgcg atgcgctgct cgccaagctc gaggacatcg ccgaggcggc gtcgcgcgac       240
     gtcacgctcc tcgtcgcgga ctggcggggc atcgagggat cggtcgtggc ggacgacgac       300
     gagacgaacg gaacccccgc gggcaaaggg ttggagcacc tgccccttca ggagggcctt       360
     ccacccggcg ttaacgtcgt gacgcgggtt gggacggtga cgcgcgccgc cctcgccgac       420
     gccgacgccc tcgcgctcat cctcgacgag catcaggctg cgtccgcgga ggagacgacg       480
     accccatcgg tggcggcccc gtattcgtcg gatgcgccgc gagccgacga gacgcccgag       540
     agggaggagg gcagccgaca gactccggcg tcgtcgacgg acgaaggggc gattgaggga       600
     gaggcgcggg agggggaagg ggacgacgcg gccgttacga ccgttacgac cgccggcgcc       660
     gacgcggcac agctggcgcg cgagtgcgtc aaacgcgcgg gtgaattttc cgtgttcatc       720
     gccgtcgagg cggaccagcg gccgcccgag ctgaggtttg atcgcgcggc gggtcccccg       780
     accgcggatc aacccgagga acccgagacg ccgccgcctt tggatgccgc cgcggccgag       840
     ggttcaggcg agggacactc cggggcgggc gacgaagagc ccggggctaa cccgctggag       900
     tctttcgagg cgtttggcag ctggttcaac aagatggtgg agacggcggc ggaccagttc       960
     accggcaata acgacgacga cggcagcagc gacgacgacg gggaagatct cagcgacggc      1020
     ggggatgccg ccgcggggat ggttaagtcc tcgggtccga agtcgcccga gaagaagccg      1080
     gcggcaaagc gggagaagcg cgattcggag agtgagagaa aggagcgcga gaggaaggaa      1140
     cgcgaagcgg aggctctccg caggtataaa cccaagaggc ccagggatgc ggcgaacggc      1200
     ctcgcggccc gttgcggcgt tcgcgccggt cgcatcctct ccgtcgccac gatgcacctc      1260
     gtccccccgc ccggcggatt cgcgcgcaca gctggcggcg cagccgaagg cacagccggc      1320
     ggcgacgacg actcggatgc cggaccggac ggggacggtt cgaaaccgct ccagcgggag      1380
     ggaggggaag gggagaccga ggcggaaaag gcggagcgcg agcgcaacgc ggcggagcgc      1440
     gcgcgggcca tgtccgagct ctaccgcaag atgatggacg agcaggacag gggcgagggc      1500
     ccgtccgacg atggggacaa gactgacggc ggcgacgaca ggaccggcgg cgagggcggc      1560
     gacctgacca actacgtcga cgacgccgag atcgaggcca tgctcgggga gaccgaggcg      1620
     gccaacaact ggagcaaggt gacggacagg gagtacgcgt gggtcaaggc ggtcggcaaa      1680
     acgtgccagg cgatcatggt ggagaagacc ctcggcttga tcgagcgtta cgcacccttg      1740
     cgagcgtacg tccggtattg ggccgcggtg gtacgggcgg atgagacgct gagtaaccac      1800
     gcggacgcgg cggagcaggc caaggccgta gccgcgaaca cgctggggcg gatcctgacg      1860
     agcgcggcgg aggggatgcc caacgtgggc ttcgtcggag ccgcggagct cgcggcgttg      1920
     caccgccgcc gcgatccgtc aatctccgcc gggtggctca aggcgctgat ttacggcgac      1980
     agcacgatga gtttcacggg cgggaccatc ctctcgctcg gcgggcccgc cgccgcgccc      2040
     gtcaccgcgc ccccggcgtt ggccatgtac tttaccatac gcctccggct ctgcctggcc      2100
     atcgcggcgc tcgggggatg cgacgtgttg ggaccggagg ctggcgcggc gactctggcg      2160
     tgttttttcg gcaccgacgc gagggagctc ctcgacgcca ggccgcgcgt ggaggagctc      2220
     gacgccctca tcgccgccgc gaacgacgcc gccgcggggg gggccgacgg ggggaacggt      2280
     ccgggtcgtt cgtcgtcgtg gcttccggat gtgtccgggg ccatgtcccg ggtcttcaag      2340
     gcgggcgcgt cggcgcagcg ggtggctcag aggtgcgcgg ccgggtacgc ggcgagggcg      2400
     tccgcgcacg tggcgcgacg cgccgctatg gggcgcgaga cgttccagtc gggaaccggc      2460
     gacgtcgacg cggactgtac cagggcgtac gaggtggcgt accagagggc gcttccccgg      2520
     gagatggtgc gggcgatggg ggagcacgtg ttcacggcgg cgaacatggt ggtcgtcgcc      2580
     gccgagctgg tcccgttcgt gtccagctac ctcaccgttc gagccgcgaa cgcggccatc      2640
     aagtgccacc tgccgcacct cgcgcccgcg gcggaggctg agctggagaa cgccaaggac      2700
     tccgcggatg cgaacgccgc ggccgcgact ccgagcgggg gatggacgaa ggacatcacc      2760
     gacggcgcct cgaaggtagc aaactcggtg ggcgcggcgg cgagcgaggc ggcggcgcgg      2820
     acgagcgccg cggccgccgc cgcgggcgcg ggcatagcgt cgctgtggag caaggcgagc      2880
     gagacggcgg cgagttcgat caaggtgacg ggtctggtga gggagggcgg gacggagccc      2940
     gtgccgcggc tttcggatcc agacgcgctg aggacgttcg tgtccaccgg gtcgggcggc      3000
     gtcgtgtga                                                              3009
//

If you have problems or comments...

PBIL Back to PBIL home page