(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE189

MICSR_1.PE189        Location/Qualifiers
FT   CDS_pept        complement(380608..381921)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636529"
FT                   /orf_name="MICPUN_56762"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62117.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A9EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E166"
FT                   /transl_table=1
FT                   /translation="MRLAHAMRASRGSPGRGPGAARAAKGETRRPGEGPAPAKASPHPR
FT                   THRLGRADRGERRRLGDSDLRVSLASLDASTWTRIGDEVEAHAQLSLAVDNGVNLVDLG
FT                   SCDHLGDGMPRSASSSSSSSATIFELTRGRADAYLGSWLRRSRDTRREDLVVAASVPFG
FT                   AAAGAAEGGAKGRRRRIKNLVERTLMAADTDHVDLLQLHYPRRDSSAMGNSDAPDEDEV
FT                   AALLDLVGDGKARFLGVDDDTRWAALETARLFANPKILVPDGLGSFVKSARGEYNLLAR
FT                   DGFECVWVEGEDAYADALRNVGLVAHSPLANGALRSRRTAVHKSHADATTAKMIQTRGE
FT                   RGARDESVWALVDAYEEVAGQFGMCLGDLALGFVRSRWFVTSVCVRARTSDALGTTLAQ
FT                   LYDIEVTEEALAEVERVARLGRVAEEVDRGRRRWSQEL"
     atgaggctcg cacacgcgat gagggcgtcg cggggatcgc ccggtcgtgg accgggcgcg        60
     gctcgcgcgg cgaagggcga aacccggcgc ccgggcgagg gccccgcgcc ggcgaaggcg       120
     tcgccccacc cccgcaccca tcgcctcgga cgcgccgatc ggggcgagcg ccgacggctc       180
     ggcgacagcg accttcgcgt gtccctcgcg agcctcgacg cctcgacgtg gacgaggatc       240
     ggggacgagg tcgaggcgca cgcgcagctg tcgctcgcgg tggacaacgg cgtgaacctc       300
     gtcgacctcg gctcgtgcga ccacctcggc gacgggatgc cccgaagcgc gtcgtcgtcc       360
     tcgtcctcgt cggcgaccat cttcgagctc accaggggcc gcgcggacgc gtatctcggg       420
     agctggctca ggcgcagccg cgatacccgc cgcgaggacc tcgtcgtcgc cgccagcgtc       480
     ccattcggcg ccgcggcggg cgccgcggaa gggggcgcca agggacgacg acggcgaatc       540
     aagaacctcg tggagcgcac gctcatggct gcggacacgg accacgtcga cctcctgcag       600
     ctgcactacc cgcgacgcga ttcgtccgcg atgggtaaca gcgacgcccc ggatgaggac       660
     gaagtcgccg cgttgctcga cctcgtgggc gacggcaagg cgaggttcct gggcgtcgac       720
     gacgacacgc gatgggccgc gctggagacg gcgaggctct tcgccaatcc gaagattctc       780
     gtcccagacg gcctcggctc cttcgtcaag tccgcgaggg gcgagtacaa cctgctggcg       840
     agggacgggt tcgagtgcgt gtgggtggag ggggaggacg cgtacgccga cgcgctgcgg       900
     aacgtggggt tggtcgcgca ctcgccgctg gccaacggcg cgctgcgcag ccgacgcaca       960
     gctgtgcaca aatcgcacgc cgacgcgacg acggcgaaga tgattcagac gcgaggcgaa      1020
     cgcggggccc gggacgaatc ggtgtgggcg ctggtggacg cgtacgagga ggtggcggga      1080
     cagttcggga tgtgcctcgg ggacctggcg ttgggtttcg ttcgcagcag gtggttcgtg      1140
     acgagcgtgt gcgtgcgggc tcggacgtcg gatgcgctcg ggacgacgtt ggcacagctg      1200
     tacgatatag aggtgacgga ggaggcgctc gccgaggtgg agagggtggc gcgtttggga      1260
     agggtcgcgg aggaggtcga tcggggacgt cgtcgctggt cgcaagagtt gtag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page