(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE19

MICSR_1.PE19         Location/Qualifiers
FT   CDS_pept        join(complement(36651..36682),complement(36455..36527),
FT                   complement(35367..36311))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636024"
FT                   /orf_name="MICPUN_56590"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62038.1"
FT                   /db_xref="UniParc:UPI000199AAB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P6"
FT                   /transl_table=1
FT                   /translation="MAKGKGADRRKSIFGSKTPAPQVPLEPVNVNSTRQAQLASEPRAT
FT                   RGMARTGKEVVVEDGFKYKRRKNKDTKAAGAGPGSNFAALGRRSTGGDEEILSEVERLR
FT                   SLDPATVFAPDDPAWTLHENIPEDLPESERLQMLIEEICELEMKRERERLVEELGPEAG
FT                   AEAAKSLEDALSEFQLKVEEMIVRGEIKFANDGDAGADLKDAKHEAMAAVLSQLEDEKA
FT                   QWDALEQEALAGASADDEASMEQMRKDVEEVNKAVEALIAAELAAENGEGGTAEELAKA
FT                   VEEAERKLAMQQEGLSALVEGVEALCTRAERAAEVFSKAIAENDFKGLPHVNSPQNLVK
FT                   NLVRGKTKK"
     atggcgaagg gtaaaggtgc cgataggcgc aagtccattt ttgggtccaa gacccccgcg        60
     ccccaggttc ccctggagcc ggtcaacgtg aactccacgc gtcaggcgca gctggcctcg       120
     gagccgcgcg cgactcgagg catggcgagg acgggcaagg aggtcgttgt cgaggacgga       180
     ttcaagtaca agcgaaggaa gaacaaggac acgaaggctg ccggtgccgg cccgggttcc       240
     aacttcgcgg cgttgggccg aagatccacg ggtggggacg aagaaatcct ttccgaggtg       300
     gagaggctcc gctccttgga ccccgccacg gtcttcgccc cggacgatcc ggcctggacc       360
     ctccacgaga atatccccga ggacctcccc gagagcgaga ggctgcagat gctcatagag       420
     gagatttgcg agctggagat gaagcgcgag cgcgagcgcc tcgtcgagga gcttggcccc       480
     gaggcgggcg ccgaggctgc caagtcgctc gaggacgccc tcagcgagtt ccagctcaag       540
     gtggaggaga tgatcgtgcg cggggagatc aagttcgcga acgacggcga cgcgggcgcc       600
     gatctgaagg atgccaagca cgaggccatg gccgcggttt tgtcgcagct ggaggatgag       660
     aaggcgcagt gggatgcgct cgagcaggag gcgctcgcgg gagcgtcggc agatgacgag       720
     gcctccatgg agcagatgag gaaggacgtg gaggaggtga ataaggcggt cgaggctctc       780
     atcgccgcgg agctggcggc tgagaacggc gagggtggta ccgccgagga gctcgcgaag       840
     gctgtcgagg aggcggagag gaagctggcg atgcagcagg aggggctgtc cgcgctcgtg       900
     gagggcgtgg aggcgctatg caccagggct gagcgcgcgg cggaggtgtt ctccaaagcg       960
     atcgcggaga acgacttcaa gggtctgccg cacgtcaact cgcctcagaa tctggtcaag      1020
     aacttggtgc gggggaagac gaagaagtga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page