(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE190

MICSR_1.PE190        Location/Qualifiers
FT   CDS_pept        382228..383127
FT                   /codon_start=1
FT                   /gene_family="HOG000265292" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636530"
FT                   /orf_name="MICPUN_107885"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG319334"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000199A9ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E167"
FT                   /transl_table=1
FT                   /translation="MAMASSGEAARPSVIDAHLHVWPSPSAYTYAEGKAPPDSLAEVSS
FT                   AESLLEQFAKAGVDGALVVQPINLKFDHSYVSSVIDKYPGKFVGCCLADPTEHGGGVDE
FT                   LRRLLDGGYRAVRFNPGLWPSGTKMTDRVGREMFALCGERNAPVGFMCFHGLDLSIEEI
FT                   ETLCTDYPETPVLMDHFGFCKGVRDPNWQKLLGLARFPQVSVKASAQFRVTPEGANGAS
FT                   WPYVSTGEQLRELIDTFGAERVVWGSDFPFVLEQCGYSGETPAAGIIRECGARLSDEEM
FT                   AAVMGGNLRRMFPGAWSR"
     atggctatgg cgtcgtccgg ggaggccgcg aggccctcgg tcatcgacgc gcacctgcac        60
     gtctggccgt ccccttcggc gtacacctac gccgaaggta aggctccccc ggattcacta       120
     gctgaggtct cctccgccga atccctgctc gaacagttcg caaaggctgg cgtggacggc       180
     gccttggtcg tccagcccat caacctcaag ttcgaccact cctacgtgtc ctcggtcatc       240
     gacaagtacc ccggcaaatt cgtcgggtgc tgcctcgcgg atccgaccga acacggcggc       300
     ggcgtggacg agctgaggcg gctgctcgac gggggatacc gcgccgtgag gttcaacccg       360
     gggctgtggc cgagcgggac gaagatgacc gatcgcgtcg gccgcgagat gttcgcgctc       420
     tgcggcgaga ggaacgcgcc cgtcgggttc atgtgcttcc acgggctcga cctctccatc       480
     gaggagatcg agacgctgtg caccgactac ccggagacgc cggtgctgat ggaccacttc       540
     ggattctgca agggcgtgcg cgatcccaac tggcaaaagt tgctcgggct cgccaggttt       600
     ccgcaggtga gcgtaaaggc ttcggcgcag ttcagggtga cgcccgaagg tgcgaacggc       660
     gcgagttggc cctatgttag cacgggggag cagctgaggg agctcatcga cacgttcggc       720
     gcggaacgag tggtgtgggg ctcggacttt ccctttgtgc tcgaacagtg cggatactct       780
     ggcgagacgc cggcggcggg gataattcgc gagtgcggcg ctcgcctgtc ggacgaggag       840
     atggcggcgg tgatgggggg taacctgcgg cggatgttcc ccggcgcgtg gtcccgatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page