(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE191

MICSR_1.PE191        Location/Qualifiers
FT   CDS_pept        complement(383200..386064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636531"
FT                   /orf_name="MICPUN_99349"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62118.1"
FT                   /db_xref="UniParc:UPI000199A9EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E168"
FT                   /transl_table=1
FT                   /translation="MQAPWVRPSTRSVGVTSTPRARCAVASSSTRATGEPSPRRCAPDR
FT                   RGGARDGRTTTIFSATTAIVPLAVAPPRRSTGRRGADFSRRGPVSLRARRARFAVVPDA
FT                   GDGETVPGGGDDDGTSDDSDPSSANQGDDRGGIVDEATEETEEEDEEDEYEEVEVEVDY
FT                   TVLDHARDAIDSLGTWSDVAGWGDDQSVTNRETSRGVGGAAGTSSFKSAATAPVSAAPG
FT                   GKLGMAPTDGVVVALAFTIGALFGRRQAEAGGASRGLAELVKSGNGGAVPGGVELRPMT
FT                   EEERIADEKRRAERRAEKERREAEATKKRKEDEAKFLAAEKKRLEKEAAEAERVRVAEE
FT                   ERRAKVRAELAERAEIERAIREEKEAKEREERERREREAEEELRKRREEEARVAAERLA
FT                   AMNAEKERRGETLKGFDVAASVTYEYRAGAGDVEVEVRARCGISSPATISDAFPTSEKA
FT                   RRGALEMCSAVAKSAVANFASDQRVRRMTGETDRCLIGVDPVTGAGFDDAEFDHWMRVS
FT                   QARTDAELRTLVMRGGAAMELKIRQPGGASNNQRETSELEFRPERASLPSADADNVANR
FT                   LTAAAAAALDNAYGVATEDLDWVARYELSALHGLDASLCFPAVSEGDGDKNRLKGTVTA
FT                   TMLTLSHWIARAKMNLASAGDAGPGLAAVSALEELASQTLSRVANAEGASWKAMYLDGF
FT                   SGDAVTRIAATARALLEEDDVIRAILERTEEEHLRKLMNQPTLDEEQFPDREEARRMRY
FT                   RAEKDAEPLAERLWAMRNSAAQLAQSGARAQARTMLEEAYTMRIDDVAKRREASGLDPA
FT                   PPGSVAPEALPELLALEECFRGEPSWDKELAGVRGQVLKAVRAAAARSLAMNDAKRAAA
FT                   LLEGAAREYGSDRKLGATHVSVAKTRDAADEAWRAAGIEADDEEAKDAALAVVAGTPVP
FT                   RGQGGGIVMKLGKTYLEELEIRRK"
     atgcaggcgc cgtgggttcg cccctcgact cggagcgtcg gggtgacgtc gacgcctcgc        60
     gcgagatgcg cggtggcctc gtcgtccacg cgcgcgaccg gcgaaccgtc cccccggcgg       120
     tgcgcgccgg accgtcgcgg cggcgcgcgc gacggaagga cgacgacgat tttttcggcg       180
     acgacggcga tcgtccctct cgcggtggcg ccgccccggc ggtcgacggg tcgacgcggc       240
     gcggactttt cccgtcgggg accggtttcg ctccgcgcgc gccgcgcgcg tttcgccgtc       300
     gtccccgacg cgggagacgg cgagacggtc ccgggcggcg gcgacgatga cggcacctcg       360
     gacgactcgg acccatcgtc ggcgaaccag ggcgacgacc gcggtggtat cgtggacgag       420
     gcgaccgagg agacggagga ggaggacgag gaggacgagt acgaggaggt ggaggtggag       480
     gtggactaca ccgtcctcga ccacgcgcgg gacgccatcg attccctcgg cacgtggagc       540
     gacgtcgccg gttggggcga cgatcaatcc gtcacaaatc gcgagaccag tcgcggggtc       600
     ggcggagcag ccggaacgtc gtcgttcaag tcggcggcga cggcgccagt ctccgcggcg       660
     cccgggggta agctgggcat ggcccccacc gacggcgtcg tcgtcgcgtt ggcgtttacc       720
     atcggcgcgc tcttcggccg acgacaggcg gaggccggcg gggcgtcgag gggcttggcc       780
     gagctcgtga agagcgggaa tggcggggcc gtgcccggcg gcgtcgagct gcggccgatg       840
     acggaggagg aacgcatcgc ggacgagaag cgccgggcgg agaggcgcgc ggagaaggag       900
     agacgcgagg cggaggctac gaagaagcga aaggaggacg aggctaagtt tctcgcggcg       960
     gagaagaaac ggttggagaa ggaagccgcc gaggcggagc gggtgcgagt cgcggaagag      1020
     gagcgcaggg ccaaggtgag ggccgagcta gcggaacgcg ccgagattga acgcgcgatt      1080
     cgcgaggaga aggaggctaa ggaacgcgag gaacgagagc gaagggagcg ggaggcggag      1140
     gaggagctga gaaaaaggcg cgaggaggag gcgcgtgtcg cggcggagag actcgcggcg      1200
     atgaacgccg agaaagagcg caggggcgag acgctcaaag gcttcgacgt cgccgcgtcg      1260
     gtgacgtacg agtatcgcgc gggcgctggc gacgtggagg ttgaggtgcg cgcccggtgc      1320
     gggatatcct ccccggcaac aatctccgac gcgttcccga cgtccgagaa ggcgaggcgg      1380
     ggcgcgctag agatgtgcag cgccgtcgcc aagtcagccg tcgcgaactt cgcgtcggac      1440
     caacgcgtgc ggcgcatgac gggggagacg gaccgctgcc tcatcggcgt ggacccggtc      1500
     acaggcgcgg gtttcgacga cgcggaattc gaccactgga tgcgcgtgag ccaggcgagg      1560
     acggacgccg agcttcgcac gctcgtcatg cgcggtggag ccgcgatgga gctcaagatt      1620
     cgtcagcccg gcggagcgtc taacaaccaa cgcgaaacgt ccgagctcga gtttcgaccc      1680
     gaacgagcct cgttgcccag cgcggatgcg gataacgtcg ccaacaggct caccgccgcc      1740
     gccgccgccg ccctcgacaa cgcgtacggc gtggcgaccg aggatctcga ctgggtcgcc      1800
     aggtacgagc tctccgcact tcacggcttg gacgcctccc tgtgcttccc cgcggtttcg      1860
     gagggtgacg gcgataagaa ccgattgaag gggacggtca cggccaccat gctcacgctc      1920
     tcgcactgga tcgcgcgcgc gaagatgaac ctcgcgagcg ccggcgacgc cggcccgggg      1980
     ctcgccgccg tgtccgctct cgaggagttg gcgtctcaga cgctgagccg ggtggccaac      2040
     gccgagggcg cgagctggaa ggcgatgtac ctcgacggct tcagcggcga cgcggtgacg      2100
     cggatcgccg ccaccgcgcg cgctcttctg gaggaggacg acgtgattcg cgccatcttg      2160
     gagcgaacag aggaggagca cctgcggaag ctgatgaacc agccgactct ggacgaggag      2220
     cagttccccg accgagagga ggcgcggcga atgcgatacc gcgccgagaa ggacgccgag      2280
     ccgctcgcgg agcgactgtg ggcgatgcga aactccgcgg cgcagctggc gcagtcgggc      2340
     gccagggcgc aggcgaggac tatgctcgag gaggcgtaca cgatgcgcat agacgacgtc      2400
     gcgaagcggc gggaggcttc cgggttggac cccgcgcccc cggggtcggt ggcccccgag      2460
     gcgctcccgg agcttctcgc gctggaggag tgcttcaggg gcgagcccag ctgggataag      2520
     gagctcgcgg gcgttcgcgg tcaggtgctc aaggcggtaa gggccgccgc cgcgaggtcg      2580
     ctcgcgatga acgacgccaa gcgcgcggcg gcgctgctcg agggcgcggc gcgcgagtac      2640
     ggctcggaca ggaagctcgg cgccacgcac gtgtccgtgg cgaagacgag agacgccgcg      2700
     gatgaggcgt ggagggcggc gggaatcgag gcggacgacg aggaggcgaa ggatgcagcg      2760
     ctcgcggtcg tcgcggggac gccggtgccg cggggacagg gcggcggcat cgtgatgaag      2820
     ctcggcaaga cgtacctcga ggagctcgag attcgaagaa aatga                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page