(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE193

MICSR_1.PE193        Location/Qualifiers
FT   CDS_pept        join(complement(390489..391526),complement(390246..390311),
FT                   complement(389410..389981),complement(388071..389274))
FT                   /codon_start=1
FT                   /gene_family="HOG000250411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636533"
FT                   /orf_name="MICPUN_93660"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62119.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG402483"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniParc:UPI000199A9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E170"
FT                   /transl_table=1
FT                   /translation="MRDSEEEKRATEEKRATSTTLNDDDLWSRVNAAPVSAFLAVAEAE
FT                   RRRNGVAPPLIREETVARAKRGGRGGGRKKGRAACRCHGLEQLDVDAFIAHLTIGPDSL
FT                   GGKGQCEHRLDVPARPTRLAPEGSPPPALRPATVAALVASGVPLHDADHARLRLFSHQH
FT                   EGICAALRGKNVCVATGTASGKSVCYNAPVLDSLLHDPDATALYLFPTKALAQDQIRAL
FT                   RVMLDGAATYLGDHAAPIDVGVYDGDTPETERTRVRAECRLVITNPDMLHVGLLPQYKR
FT                   WARVFKGLKYVVLDEAHVYRGVFGSHVSLVVRRLRRISRELYGSDPRFIVTSATIANPR
FT                   EHAVDLWEVIDVDGSPSGEKTFLMWNPPAPRSSPIVEVAALLAECVRHDLKCIAFCKTK
FT                   KLCELVLRYCREILRDTGAGHLADSVAAYRGGYAAVDRRAVEGALFGGALRGVAATNAL
FT                   ELGVDVGYLDCTLHLGFPGTVASLVQQSGRAGRRGRRALGVYVAFDGPLDQYFMRDPAR
FT                   LFERPIERAAVDPQNFKIMRAHAQCAAHEIPLDPRVAEDNRPGGGGGGGGGGPAPDARL
FT                   VWCGGLVSDGERGPANGVSIRTIEEERYRIVDEASGRVIEEVEASKAFWEVYPGAVYLN
FT                   QARTYLCKSLDVESRTARVRLADVKYFTGTVDATTVTLVQHGSQRHAYPHRPGPAHRRP
FT                   QFPGTTAQCAECEIKVTFSAYHKIWQGTGRVFDTVSLNLPDVTYKTRAAWIRVPDGARR
FT                   ECEESGVDFRAGVHAATHAMINALPLFLMVNQSDVGAECDDPQRGHYKPTRILIFDRQP
FT                   GGVGIAERAAPVFPRLLRAAIELIEECRDCRGDRAGVAKGTGPDPPGDGSRGRREADGE
FT                   GGPDSASQTPASQTPRDQSGCPGCVHYLACDVYNVSLDRLAALVVLRSIVNAEEGTFGS
FT                   FEDAAGSDLTAAGDGRGCCANGRHGNVGA"
     atgcgggatt ccgaagagga gaagcgtgct actgaggaga agcgtgccac ctcaacgacc        60
     ctaaacgacg acgacctctg gtcgagggtc aacgccgcgc cggtgtcggc gtttctcgcg       120
     gtcgcggagg ctgagcgccg tcgcaacgga gtcgccccgc ctctcatccg ggaggagaca       180
     gtcgcgcgtg ccaagcgggg cgggcggggc ggcgggagga aaaagggaag ggccgcctgc       240
     aggtgccacg gcctcgagca gctcgacgtc gatgcgttca tagcgcacct gacgatcggg       300
     ccggactccc tcgggggtaa gggccagtgc gaacaccgcc tggacgtgcc cgcgaggccc       360
     acgcggctgg cgcccgaggg ttccccgccc cccgcgcttc gcccggctac cgtcgccgcg       420
     ctcgtcgcgt ccggcgtccc tctccacgac gcggaccacg cgcgcctgcg gctcttctcg       480
     caccagcacg agggcatatg cgcggcgctg cggggcaaga acgtgtgcgt cgccaccggc       540
     acggcgagcg gtaaatcggt gtgctacaac gccccggtgc tcgattctct cctgcacgac       600
     ccggacgcca ccgcgctgta cctgttcccg accaaggcgc tggcgcagga tcagattcgt       660
     gcgctgaggg tcatgctcga cggcgccgcc acctacctcg gcgatcacgc ggcacccatc       720
     gacgtcggtg tgtacgacgg cgacaccccg gagacggagc gaactcgcgt tcgcgccgag       780
     tgccgcctcg tcatcaccaa ccccgacatg ttacacgtcg gcctcctgcc ccagtacaag       840
     cggtgggccc gggtgtttaa gggactcaag tacgtggtgc tcgacgaggc gcacgtgtac       900
     cgcggcgtgt tcggctcgca cgtgtccctc gtcgttcgaa ggcttcggag gatatcgcgg       960
     gagctgtacg gctcggaccc gaggttcatc gtgacgagcg ccacgatcgc gaacccccgc      1020
     gagcacgcgg tggacctgtg ggaggtcatc gacgtggacg gttcgccgtc gggggagaag      1080
     acgttcctga tgtggaaccc accggcgccg aggtcgtcgc ccatagtgga ggttgccgcc      1140
     ctgttggcgg agtgcgtccg ccacgacttg aagtgcatcg cgttttgcaa gaccaagaag      1200
     ctgtgcgagc tggtcctgcg gtactgcagg gagatcttgc gggacaccgg cgcgggtcac      1260
     ctcgccgact cggtcgcggc gtacaggggc gggtacgccg cggtcgacag gcgcgcggtg      1320
     gagggggcgc tcttcggcgg ggcgctgcgg ggcgtggcgg cgacaaacgc gctcgagctg      1380
     ggcgtcgacg tgggctacct cgactgcacc ctgcacctcg ggttcccggg caccgtggcg      1440
     tcgctcgtgc agcagtcggg gcgggcgggg cggcgcggga ggcgggccct gggggtctac      1500
     gtcgcgttcg acggcccgct cgaccagtac ttcatgcggg atcccgctag gctgttcgag      1560
     aggccgattg agcgcgcggc ggtggatccg caaaatttta aaatcatgcg agcgcacgcg      1620
     cagtgcgcgg cgcacgagat tccgctcgac ccgcgcgtcg ccgaggataa cagaccgggc      1680
     ggcggcggcg gcggcggtgg cggcggtccg gcgcccgatg ctcggctcgt ctggtgcggc      1740
     gggctcgtga gcgacgggga gcggggcccg gcgaacggcg tgagcatccg cacgatagag      1800
     gaggagcgct accgcatcgt ggacgaggcc tcggggcggg tcatcgagga ggtggaagcc      1860
     tccaaggctt tctgggaggt gtaccccgga gccgtctacc tgaaccaggc gcggacctac      1920
     ctgtgcaaat ccttggacgt cgagtcgagg acggcgcgcg tccgcctcgc ggacgtcaag      1980
     tacttcacgg gtaccgtaga cgccaccacg gtgacgctcg tgcaacacgg ctcgcagcga      2040
     cacgcgtacc ctcacaggcc gggccccgcg caccggcgcc cgcagtttcc gggcaccacc      2100
     gcgcagtgcg ccgagtgcga gataaaggtc accttctcgg cgtaccacaa gatctggcag      2160
     ggcaccgggc gcgtctttga caccgtgtcg ctgaatttgc cggatgtgac gtataaaacg      2220
     agggcggctt ggattcgagt ccccgacggc gcgagacgag agtgcgagga atcgggcgtt      2280
     gatttccgag ccggcgtgca cgccgcgacg cacgccatga tcaacgccct ccccctgttt      2340
     ctcatggtga atcagagcga cgtgggcgcc gagtgcgacg accctcagcg cgggcactac      2400
     aagcccacgc ggatcttgat cttcgacagg cagcccgggg gcgtcggcat cgcggagcgc      2460
     gcggcgcccg tgttcccgcg gctgctccga gccgcgattg agctcatcga ggagtgtcgc      2520
     gactgtcgcg gcgaccgcgc gggggtcgcg aaggggacgg gtcccgaccc cccgggggac      2580
     gggtcccgag gacggcgcga ggctgacggg gagggaggac cggattccgc ctcgcaaacc      2640
     ccggcttcgc aaaccccgcg ggatcaatcg ggttgccccg ggtgcgtgca ctacctcgcg      2700
     tgcgacgtgt acaacgtgtc gttggacagg ctcgccgcgc tcgtcgtcct ccggtcgatc      2760
     gtgaacgcgg aggaggggac gttcggaagt tttgaggacg ccgccggttc agatctgacg      2820
     gcggcggggg acgggcgcgg gtgttgcgca aacggacgac acggaaacgt gggggcctga      2880
//

If you have problems or comments...

PBIL Back to PBIL home page