(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE194

MICSR_1.PE194        Location/Qualifiers
FT   CDS_pept        393339..394739
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636534"
FT                   /orf_name="MICPUN_56767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61687.1"
FT                   /db_xref="HOGENOM:HBG560044"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A9F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E171"
FT                   /transl_table=1
FT                   /translation="MAKTSATSTAPNDAPASSPAAGGDGWTQRVLTLNPKRRGIFIWTD
FT                   ALRKNVPEIASCKAGVLNLFLRSTTAALSVNENADPDVRTDLENALDRVVPGTDVLDAT
FT                   ARSAFVGVSLDVPVQGGKLALGTWQGLYLCEWADGAEPCQVVATLVDASDDVRCTRNVT
FT                   VRAPRRGCHLVQDEVDDAFKPARDRTFKPDRTNKPGLANLLIRHTSASLTLNENADPTA
FT                   RGDLENALNRIVPEEWHSTLFSHVEEGPDDMTAHVKSTLLGCSLTVPVDAHGAMKTGTW
FT                   QGVYLCEHRNVGGMGVGHAREVATTLIDGAGVANTAGQTTVTLTAPGRGCHDVTAEIAA
FT                   AAKAIGVGSNVRTGWLNVFVQHTSASLAVCDSTLAGAGDRLERALNETVPESWNDEFFV
FT                   HTYEGPDDMPGHVKASIVGCSVTVPIVDGELGLGKAQGLFLCEHRDAGGYGCNLNRKVV
FT                   LTLQGVDK"
     atggccaaga cgtcggcgac gtccaccgcc ccaaatgatg ccccggcgtc gtccccggcc        60
     gcggggggcg acgggtggac gcagcgggtc ctgacgctga acccgaagcg gcgcgggatc       120
     ttcatctgga ccgacgcact gcgcaagaac gtgccggaga tcgcctcgtg caaggcggga       180
     gtcctcaacc tcttcctccg gtccaccacc gcggcgctct ccgtcaacga gaacgccgat       240
     ccggacgtga ggaccgacct cgagaacgcg ctcgacaggg tcgtcccggg caccgacgtc       300
     ctcgacgcga ccgcgcgcag cgccttcgtc ggagtctcct tggacgtgcc cgtgcagggc       360
     ggcaagctcg ccctcggcac gtggcagggg ctctacctgt gcgagtgggc cgacggcgcc       420
     gaaccgtgcc aagtcgtcgc caccctcgtc gacgcatccg acgacgttcg atgcacccgc       480
     aacgtcaccg tccgagcccc gcggcgcgga tgccacctgg tccaggacga ggtggacgac       540
     gcgttcaaac ccgcgaggga tcgaacgttc aaaccggatc gcactaacaa acccggactc       600
     gccaacctgc tcatcaggca cacgtccgcg tcgctgacgt tgaacgaaaa cgcggatccg       660
     acggcgcggg gcgatttaga gaatgcgctg aaccgaatcg tgcctgagga gtggcacagc       720
     accttgttct cgcacgtcga ggagggcccg gacgacatga ccgcgcacgt caagtccacc       780
     ctcctcgggt gctcgttgac ggtgccggtg gacgcgcacg gcgcgatgaa gacggggacg       840
     tggcaggggg tgtacctgtg cgagcacaga aacgtgggcg ggatgggcgt cggacacgcg       900
     agggaggtgg cgactaccct gattgacggc gcgggcgtcg caaacaccgc ggggcagacg       960
     acggtgacgc tcaccgcgcc cggcagggga tgccacgacg tcaccgccga gatcgccgcc      1020
     gccgcgaaag ccatcggcgt cggatcaaac gtgcgcacgg ggtggctcaa cgttttcgtg      1080
     cagcacacca gcgcgtcgct cgcggtgtgc gattcgacct tggcgggggc gggcgatagg      1140
     ctggagcgcg cgctgaacga gacggtgccg gaatcatgga acgacgagtt cttcgttcac      1200
     acgtacgagg gaccggacga catgcccggg cacgtcaagg cgtccatcgt cggttgctcc      1260
     gtcaccgtgc caatcgtgga tggcgagttg ggtctgggca aagcgcaggg tttgtttctg      1320
     tgcgagcatc gcgacgcggg tgggtacggg tgcaacctca accgcaaggt ggtgctgacg      1380
     cttcagggcg tcgacaagtg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page