(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE195

MICSR_1.PE195        Location/Qualifiers
FT   CDS_pept        join(complement(395293..395436),complement(395142..395215),
FT                   complement(394850..395063))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636535"
FT                   /orf_name="MICPUN_56768"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62120.1"
FT                   /db_xref="UniParc:UPI000199A9F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E172"
FT                   /transl_table=1
FT                   /translation="MPTYGTHTPDVKYVPSSLMAFGYKGVKPVPGVPNMYLKDYQDNLF
FT                   EMDIKDGAAGVSNCNFHWNDCDIAPRFGNHEDRVADKDIKYRPNVANICPRPKDWKPGK
FT                   YQSKGVDGVDVNYPRIDERNRKYWGSAGGSHAKTFPSDE"
     atgcccacct acggcacgca cacccccgat gtcaaatacg tgccctcgtc tctcatggcc        60
     ttcggttaca agggcgtcaa gcctgtgccc ggggttccca acatgtactt gaaagattac       120
     caagacaatc tgttcgagat ggacatcaaa gacggcgccg cgggagtgag caattgtaat       180
     tttcactgga acgactgtga catcgcgccc cgcttcggga accacgagga cagggtcgcc       240
     gataaggata tcaagtaccg cccgaacgtc gccaacatct gcccccgtcc caaggactgg       300
     aagccgggca agtaccagag caagggcgtc gacggcgtcg acgtcaacta cccgaggatc       360
     gacgagcgca acaggaagta ctggggatca gccggcggat cacacgcgaa gacgttccca       420
     tccgacgagt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page