(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE196

MICSR_1.PE196        Location/Qualifiers
FT   CDS_pept        complement(395586..398315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636536"
FT                   /orf_name="MICPUN_99353"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62121.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199A9F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E173"
FT                   /transl_table=1
FT                   /translation="MKRKAPASPPPGRDDVTVETFVHEDFAGRYDGEVDDEGRPHGAGI
FT                   LRLDDDGAWYEGEFRRGARHGQGTLHFPPDDDDDDDEDEDEDHDRKHGPMPETSLEGLS
FT                   TRGDRVVGSFADDAIEGYAEYLSSDGTRRAGLWHDGELSGLIEEFDEDGECVFGGEMDA
FT                   DGNKNGRGWFSFPDGGCYGGQLAAGKPDGKGLYLFPLTYGVCPPESKLAAATFAFWGMY
FT                   QSETKEWEAWDHRRDQAELEWQKVADGKRCPTSLAAKPDLEKDWRDEEPGPWSESPEMC
FT                   GDDPEPPAGMPERMCMYGEWVGGKCVRAGFYEGFGFWKEHFWAQPHLSPLLADIFMCFF
FT                   ELGHTEGHGEERYAIAKAAGLSMRDEIEKFQLYSTEQGCHMPNNSEGPWGVVKAGADSY
FT                   SGEKPRNHEPGELLGFVSGRRRALRGGWGERRWLPSDKIFFLGDDDGAPDPPAEGSGAD
FT                   PDGGSGAGGVFIIADDTDPVPGEAKVPDYDSEGDEKTFLTNIDVPLKRKDGSRRRIYTT
FT                   LGEHAKVVVRDPPNCERRPYVHPVLGNILALVATRKITRDEDITVPPCYDTGWRLNPRT
FT                   EAGYYYHLKNSPPAELFESGRGGEAGVGKVYVRAHGPWRALWLDKVEQGLAYDFNAGKA
FT                   YAEDPAFVDFKHDPAVLGFEYVRAMATAAVAAIGANALNARTRALCVGLGAGALPAFLS
FT                   RVVGLDVLCVEIDADVADAARNFLGVDFRETNPDDAFDVFNERSTLNDDRLSAARGSGF
FT                   GLVIEDIADFLDRDECAGSFDVVLLDAYDGEGRVPAHLRDPENKFVQKVLGSVRPNSGC
FT                   IVANLWNSEDRAEFSRERRELEEFRKQLAAGGASARADVTVSGQENNVVVLAASGAAGG
FT                   GHLASGALRRSLVEIVKAHPGVGASLVPPEHFAATEPY"
     atgaagcgca aggcgcccgc gtcccccccg ccagggagag atgacgtcac ggtcgaaacc        60
     ttcgtccacg aggacttcgc cggccgatac gacggtgagg tggacgacga gggtcgcccg       120
     cacggcgcgg gcatcctgcg actcgacgac gacggcgcct ggtacgaggg cgagttcagg       180
     cgtggcgcac ggcacgggca gggcaccctc cacttcccgc cggacgacga cgacgacgat       240
     gatgaggatg aggatgagga tcacgaccgt aaacacgggc cgatgcccga gacctcgctc       300
     gagggactgt ccacgcgagg ggatcgcgtg gtgggctcct tcgccgacga cgccatcgag       360
     ggatacgccg agtacctctc gagcgacggc acccggcgcg cgggcctctg gcacgacggc       420
     gaactctccg gcctgatcga ggagttcgac gaggacggcg agtgcgtctt cggcggggag       480
     atggacgccg acgggaacaa gaacggccgg ggttggttct ccttccccga cgggggatgc       540
     tacggcggcc agctcgcggc tgggaaacca gacggcaagg gcctctacct cttcccgctg       600
     acctacggcg tgtgcccccc ggagagcaag ctcgccgccg ccacgttcgc gttctggggc       660
     atgtaccagt cggagacgaa ggagtgggag gcgtgggacc atcgaaggga ccaggctgag       720
     ttggagtggc aaaaagtcgc cgacggcaag cgatgcccca cgtcgctggc ggcgaaaccc       780
     gacctggaga aggattggcg agacgaggag cccgggccgt ggagcgagag cccggagatg       840
     tgcggcgacg acccggaacc gcccgcgggg atgcccgagc gcatgtgcat gtacggcgaa       900
     tgggtcggcg gcaagtgcgt tcgcgcgggg ttttacgagg gattcggttt ttggaaggaa       960
     cacttctggg cgcagccgca cttatcgccg ctgctcgcgg acatattcat gtgcttcttc      1020
     gagctcgggc acacggaggg gcacggcgag gagcggtacg ccatcgcaaa ggcagcgggg      1080
     ctgtccatgc gggatgagat tgagaagttt cagctgtaca gcaccgagca ggggtgccac      1140
     atgccaaata attcagaggg tccgtggggg gtggtgaagg ccggagcgga ctcgtacagc      1200
     ggggagaagc cccgcaacca cgagcccggc gagctgctcg ggttcgtatc cggcaggagg      1260
     cgcgcgctgc ggggtgggtg gggcgaacgg aggtggctcc cttcggacaa gatttttttc      1320
     ctcggcgacg acgacggggc tccggacccg cccgcggaag gttccggcgc ggatccggac      1380
     ggtggaagcg gcgcgggggg cgtgttcatc atcgcggacg acaccgatcc ggtaccgggc      1440
     gaggcgaagg ttccggacta cgactccgag ggcgacgaga aaaccttcct gacgaacatc      1500
     gacgtcccgc tcaagcgcaa ggacggcagc cgaaggcgga tttacacgac gctcggcgaa      1560
     cacgccaagg tggtggtcag ggacccgccc aactgcgagc gcaggccgta cgtccacccc      1620
     gtgctgggga acatccttgc gctcgtggcg acgcggaaga tcacgaggga cgaggacatc      1680
     accgtcccgc cgtgctacga tacgggttgg aggctcaacc cccggaccga ggctgggtac      1740
     tactaccacc tcaagaattc gccccccgcg gagctgttcg agtcggggcg gggcggcgaa      1800
     gccggcgtcg gcaaggtgta cgttcgcgcg cacggaccgt ggcgcgcgct gtggctggac      1860
     aaggtcgagc agggactcgc gtacgacttt aacgccggca aggcgtacgc ggaggatccc      1920
     gcctttgtcg acttcaaaca cgaccctgcc gtgctgggat tcgagtacgt cagggcgatg      1980
     gccacggcgg cggtggcggc gattggcgcg aatgccctga acgcgcggac ccgcgcgttg      2040
     tgcgtgggtc tcggcgccgg tgccttgccc gcgtttttaa gtcgagtggt cggcctggac      2100
     gtgctctgcg tggagatcga cgccgacgtc gccgacgccg ctcgtaactt cctcggcgtc      2160
     gactttcgcg agacgaaccc ggacgacgcg ttcgacgtct tcaacgaacg ttcaacgttg      2220
     aacgatgacc gactttctgc tgctcgcggt agcgggttcg ggctcgtcat cgaggatatc      2280
     gccgactttc tggatcgcga cgagtgcgcc gggtcgttcg acgtcgtcct gttggacgcg      2340
     tacgacggcg aaggacgggt ccccgcgcac ctcagggacc cagagaacaa attcgtgcag      2400
     aaagtgctgg gttccgtccg tcccaatagc gggtgcatcg tcgcaaacct ctggaacagc      2460
     gaggaccggg cggagttcag tcgggagcgg cgggagctcg aggagtttcg gaagcagctg      2520
     gcggcgggcg gcgcgagcgc gagggcggac gtgacggtga gcgggcagga gaacaacgtg      2580
     gtggtgctgg cggcgagcgg tgcggcgggt ggggggcact tggcgagcgg ggcgctgcga      2640
     aggtcgctgg tcgagatcgt gaaggcgcat ccgggggttg gggcgtcgct ggtgccgccg      2700
     gagcacttcg cggcgaccga gccgtattag                                       2730
//

If you have problems or comments...

PBIL Back to PBIL home page