(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE197

MICSR_1.PE197        Location/Qualifiers
FT   CDS_pept        398943..399830
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636537"
FT                   /orf_name="MICPUN_107886"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61688.1"
FT                   /db_xref="UniParc:UPI000199A9F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E174"
FT                   /transl_table=1
FT                   /translation="MWRRMAWEKFGREWFDACETDESILYYEHPQPNHDKWYLRLRDRE
FT                   TVVQDNGMYEITTITEYGHEAEEYRASKKMPAGATECEWAGRKYKLHNYSPPPICVDST
FT                   KEISFKLHLKCIWDVVEAAWNMMCDEVDVPSYADVRRFFYRPGQIMSMSEPECWYDDED
FT                   GEPNDRKYDRETTIQAAKEFCGNLLGLMMKHFEGADHVLRKCDWPEGEDWTDMRKEEYS
FT                   EAFKEVVDKQCEVRDGRSWSLIPLLHDKRTRVVDMLVDRIGGFRYKEGIVRTLKVLDGF
FT                   KMIDGVVTNTSIHG"
     atgtggcgtc ggatggcgtg ggagaagttt gggcgagaat ggttcgatgc gtgcgagacg        60
     gatgagtcga tcctctacta cgagcacccg caacccaatc acgacaagtg gtacctcaga       120
     ctcagagacc gagagacggt cgtgcaggac aacggcatgt acgagataac cacgatcacc       180
     gagtacggcc acgaggcgga ggagtacaga gcctcgaaaa agatgcccgc gggagcgaca       240
     gagtgcgagt gggcggggcg gaagtacaag cttcacaact acagcccccc ccccatttgc       300
     gtggactcga cgaaggagat ttctttcaaa ctgcacctga aatgcatctg ggacgtggtg       360
     gaagcggctt ggaacatgat gtgtgacgag gttgacgtgc cctcgtacgc ggatgttcgc       420
     cgcttcttct acaggcccgg ccagatcatg tccatgagcg agcccgagtg ttggtacgac       480
     gatgaggacg gtgagccaaa cgaccgcaag tacgacagag agacgacgat ccaggcagcg       540
     aaggagttct gtggtaatct cttgggactc atgatgaagc acttcgaagg cgcggatcac       600
     gtgctgagga aatgcgactg gccagaagga gaagactgga cagacatgcg gaaagaagaa       660
     tactccgagg ccttcaagga ggtggtggac aagcaatgcg aggtcaggga cggtcgctcg       720
     tggagcctga ttcccttgct gcacgacaag aggacccgtg tcgtcgacat gctcgtggat       780
     aggatcggag gtttccggta caaggagggc attgtacgta ccttgaaggt acttgatggc       840
     ttcaaaatga tcgacggtgt ggttaccaac acatcaattc acggttag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page