(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE199

MICSR_1.PE199        Location/Qualifiers
FT   CDS_pept        404237..405268
FT                   /codon_start=1
FT                   /gene_family="HOG000100023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636539"
FT                   /orf_name="MICPUN_56772"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61690.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG560049"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="UniParc:UPI000199AA57"
FT                   /db_xref="UniProtKB/TrEMBL:C1E176"
FT                   /transl_table=1
FT                   /translation="MIATPMTATAPTRAIVSSTSIRRAIRPARVLGAPARRCRHTTLAT
FT                   SDSSDPAEGKGKEGAEEGDGISLDDLRILQQRVESIREREAKMDVLQLLVLDASVPGQV
FT                   LPLQFDAGGDPRRPLNGGTYVGEDVNLGDRFGMLGQAPSNGQILPNGVEVTVTRVLLKP
FT                   DGSSMVELTAGRRFKVHGQPFEDPDNDDAPSGRVVWIDPDLGAGEQTVEGADPALVHPE
FT                   APAPRDPATYDEESERLCRELPALVSTWRALVRDTGRERQPNQLELIEKHLGPQPGVSK
FT                   PARLACWVAGLINPIPALGVAYEIRPAMLMATTVGDMIGVAHKGISLSIKGLRKSAGDV
FT                   DAE"
     atgatcgcga cgccgatgac agcgaccgca cccacgcgcg cgattgtctc atccacgtcg        60
     attcgccgcg cgatacgccc cgcgcgggtt ctcggcgcgc ccgctcggag gtgtcgtcac       120
     acgacgcttg ccacgtcgga ctcttccgat cccgcggagg gcaagggcaa ggagggcgca       180
     gaggagggtg acggcatctc cctcgacgac ctccgcatcc ttcagcagcg cgtcgagtcc       240
     atccgcgaga gggaggcgaa gatggacgtc ctgcagctgc tcgtgctcga cgcctcggtc       300
     ccgggccagg tgctcccctt gcagttcgac gccgggggcg atccgaggcg gcctctcaac       360
     ggtggcacgt acgtgggcga ggacgtcaac ctcggcgatc gcttcgggat gctcgggcag       420
     gcgcctagca acggacagat cctccccaac ggcgtcgagg tgaccgtcac gcgcgtcctc       480
     ctcaaacccg acggctcgtc catggtggag ctgacggcgg gacggcgatt taaggtgcac       540
     ggacagccct tcgaggaccc ggacaacgac gacgccccga gcggcagggt ggtgtggatc       600
     gaccccgacc tgggcgcggg ggagcagacg gtggagggcg cggacccggc gttggtccac       660
     ccggaggcgc cggcgccgag agacccggcg acgtacgacg aagaatccga gcgactgtgc       720
     cgcgagctcc ctgcgttggt ctccacgtgg cgcgcgctgg ttcgcgacac cgggcgcgaa       780
     cgccagccca accagctgga gctcatcgag aaacacctgg gtccacagcc cggggtgtcg       840
     aagcccgcga ggttggcgtg ctgggtcgcg ggtttgatca acccgatacc cgcgctcggc       900
     gtcgcgtacg agattcgacc ggcgatgttg atggccacca ccgtcgggga catgatcggg       960
     gtggcgcaca aggggatcag tctgagcatc aagggcctac ggaagagcgc tggggacgtg      1020
     gacgcggagt ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page