(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE2

MICSR_1.PE2          Location/Qualifiers
FT   CDS_pept        complement(2196..3374)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636007"
FT                   /orf_name="MICPUN_107844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62029.1"
FT                   /db_xref="UniParc:UPI000199A9EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M9"
FT                   /transl_table=1
FT                   /translation="MVDSGNQWKTRGYLPGVNTWGSRVDTWRVKDFVTTVETSLREAAS
FT                   SVFARCQYGQVGESLKQLASVCSGLSFAERTKILDAASKLLNNLTAFNGTDMTLGNAGD
FT                   TNLQPDANSTDGDASYSVDTAIVRVPTDNETLAAACMGTVVSNSADSSVAPVTSRRRTS
FT                   RRRLSQAEADAATLQDAGCWSRVRNSNDALVGMLLGECIQVSLGAGQQLLDGVKACLKT
FT                   KPDRAINVDYTQDIFVKRTTVNGVEKYTPMSTITVERVGTQICGKVTDVGSFFCPARVA
FT                   PNWATATTDIGSTECPIVDVIGAAKLAAIETIRNRNKASGEKDGPLPGLDQASGIAVLA
FT                   VMCLFICGCCVGCRWLVVRRRRRQQAAAGKAMVVHNTLIHSQTQVVQSTAQP"
     atggttgaca gcggcaacca atggaaaacc cgcggatacc tgccgggcgt caacacttgg        60
     ggatcacgcg tcgacacctg gcgagtcaaa gattttgtta ccaccgtcga aaccagcctc       120
     agggaggccg ccagctccgt gttcgcgcgt tgccagtacg gtcaggttgg cgaatctctg       180
     aaacagttgg ctagcgtgtg cagcggcttg agcttcgccg aacgcacgaa aatcctcgac       240
     gcagcctcaa agctcctgaa caacctgacc gcgttcaacg gcacagatat gaccctcgga       300
     aacgccggcg acacaaacct tcaacccgac gcaaactcga ccgacggcga cgcctcatac       360
     agcgtcgaca ccgcgatcgt ccgggtcccc accgacaacg aaactctcgc cgctgcgtgc       420
     atgggaacgg tcgtgagcaa ctccgccgat agctcggtcg ccccggtcac cagccgtcgt       480
     cgcacctcgc gccgccgtct ctcgcaggct gaggccgacg cggctacttt gcaggatgcg       540
     ggatgctgga gtagggttcg caacagcaac gacgctctcg tgggcatgct cctcggggag       600
     tgcatccagg tgtccctcgg tgccggccag cagctcctcg acggcgtcaa agcctgtctc       660
     aagaccaagc ccgaccgagc catcaacgtg gattacaccc aggatatctt tgtcaagaga       720
     accacggtga atggcgtcga aaagtacacg ccgatgtcca ccattaccgt cgagcgtgtt       780
     ggcactcaga tctgcggcaa ggtcaccgac gtcggatcct tcttctgtcc cgcgcgggtt       840
     gcgccaaact gggcaaccgc aaccaccgac atcggctcga ctgaatgccc catcgtcgac       900
     gtcatcggcg ccgcaaagtt ggccgccatc gaaactatcc gcaacaggaa caaagcatcg       960
     ggcgaaaagg acggcccgct cccaggtttg gaccaggcgt ccggaatcgc cgtactcgcc      1020
     gtcatgtgcc ttttcatctg cggctgctgc gtcggatgca ggtggttggt cgttcgcagg      1080
     cgccgccgcc agcaggcagc cgcaggcaaa gcgatggttg ttcacaacac actcatccac      1140
     tcacagacac aggtcgtcca gtcgactgct cagccatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page