(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE20

MICSR_1.PE20         Location/Qualifiers
FT   CDS_pept        36845..38251
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636025"
FT                   /orf_name="MICPUN_56591"
FT                   /product="Predicted protein"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO61594.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG560051"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI000199AAB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P7"
FT                   /transl_table=1
FT                   /translation="MADQAGQKKPYDYQERYRHVRQKPLSVYSVEVKGDERTRPGLFAR
FT                   VLDPVYRASTLDELRVRCVEANAVLNSYDIFDRVDIEMDAGPREHPDSAKVTVEVSEKK
FT                   KLNLKGGAYVSQQGEGSMEVSVGLNNALGYAEKLDVEFIKGHERSNSCTLAWNQPRVGN
FT                   VDVDVVTRAFQQVSCSKRLSSFDETARGISVTAVGGGPATVDYSLVWREIADPTRLASK
FT                   SIRQQLGHSLKSSVSYTYQVDERDRPVRPGAGYLARVRSELAGVGWDPQMTRFLKHEAE
FT                   VQAAHTPAEGVTFFASAKLGAMMPLGQNAKDPEKGTCIADRFFLGGVGSLRGFEPHGAG
FT                   PSDERRPPPTKAAASGENLITRDALGGDVLAQLFASYQLEPEWSKLRDIGVYGHFFVNA
FT                   GTLMPWITGERKRVSGRELADSFRASVGVGLVFPLPVGNIEVNYCHTLRSRPGDRVKNG
FT                   LQIGLATALA"
     atggccgacc aggcaggcca gaagaagccg tacgactacc aggagcggta ccgtcacgtc        60
     cgccaaaagc ctctttcggt gtattccgtg gaggttaagg gcgatgagcg cacccgcccc       120
     ggcctgttcg ccagggtgct cgatccggtg tacagggctt ccaccctgga cgagctccgc       180
     gtgcgatgcg tggaggccaa cgcggtgctg aacagctacg acatcttcga ccgggtagat       240
     atcgagatgg acgcgggccc cagggagcat cccgatagcg ccaaggtgac cgtcgaggtg       300
     tccgagaaga agaagctcaa cctcaagggc ggcgcgtacg tatcgcagca aggcgagggt       360
     tcgatggagg ttagcgtcgg gctgaacaac gcgctcgggt acgcggagaa gctggacgtc       420
     gagttcatca agggccacga gcgatcaaac tcgtgcacac tggcgtggaa tcagccgcgg       480
     gtcggtaacg tggacgtgga cgtcgtcacg cgtgcgttcc agcaggtgtc gtgctccaag       540
     aggctctcct cgtttgacga gacggcgcga ggtatctccg tcaccgcggt gggcggcgga       600
     cccgccaccg tggactactc gctcgtgtgg agggagatcg cggatccaac gcgtctcgcg       660
     tccaagtcga tcaggcaaca gctcggtcac tcgctcaagt cgtcggtctc gtacacctac       720
     caggttgacg agcgcgacag gccggttcga ccgggggcgg ggtacctggc gagggtccgg       780
     agcgagctcg ccggagtggg ctgggacccg cagatgacca ggtttctcaa gcacgaggcg       840
     gaggtccagg cggcgcacac gcccgcggag ggcgtcacct tcttcgcgag cgcaaagttg       900
     ggagccatga tgccgctggg tcagaacgcc aaggacccgg agaagggaac gtgcatcgcc       960
     gacaggttct tcctcggcgg cgtcgggtct ctcaggggtt tcgaacctca cggcgcgggg      1020
     cccagcgacg agcgaaggcc gccgcccacc aaggctgcgg cgagcggaga gaacctcatc      1080
     acccgcgacg cgctcggcgg agacgtgctg gcgcagctgt ttgcttccta ccagctggaa      1140
     cccgagtgga gcaagttgcg ggacatcggc gtctacggac acttcttcgt caacgcgggg      1200
     acgctgatgc cgtggatcac gggcgagcgc aagagggtga gcgggaggga gctcgcagac      1260
     tcgttcaggg catccgtcgg tgtgggcctg gtgttcccgc tgcccgtggg gaacatagag      1320
     gtcaactact gtcacactct gcgcagccga ccgggcgatc gggtcaagaa cggcctccag      1380
     ataggtctag ccaccgcctt ggcgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page