(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE200

MICSR_1.PE200        Location/Qualifiers
FT   CDS_pept        405419..407098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636540"
FT                   /orf_name="MICPUN_56773"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61691.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AA58"
FT                   /db_xref="UniProtKB/TrEMBL:C1E177"
FT                   /transl_table=1
FT                   /translation="MATSATPAGLRAPSAGRARSSRTRILAISRATSATATSQDVIARG
FT                   SARRVQIPVVDLSEPDAVCASIVRTACDSCGFFHVVNHGVDDNLAFDVIRWGATFFDRP
FT                   WDDKMALVRGDMRVSRGYEISPEHIEALDRDVTREEELAAREPSAARRIISERFSVGPF
FT                   DVPNDSYHTDEEGALFFHPNAWPEDSIPSLRPAMEAYYREMESLCARLHRVLALAMGAP
FT                   ADFFEDKIDKHCSNLQVANYPSLDPSRWRDSDRIPLRKKSHADSGTLTVLWRSPPTEGT
FT                   KGGLQVLDDTAGTWVDVPVLPGGNERESGALLINLGNQTQRWTDGKWVSTKHRVTNPDV
FT                   HAPGYAPSRRLSVAFFHKANYDAVIDHRDFVPGRERDAPSVSYPPVRSGDVSRVGALRR
FT                   LGRGVDAREASMRYHEELMGGRDRAERAAGESTAVKIDASAETEGEPPKKGEPPKKAEP
FT                   EADRWASLMDPRGQAGPISAGDLGLDRGASAEGAGAGNDNPAAGCPVCRGTGWKPCGQC
FT                   GGTGINREDLFGGKFKEGDTCWLCSGKKKTMCGNCVDLTDSF"
     atggcgacgt cggcgacccc ggccgggtta cgcgcgccga gcgcgggccg cgctcgatcg        60
     agccgcacgc gcatcctcgc gatctcccgc gccacctccg caaccgcgac ttcgcaggat       120
     gtcatcgctc ggggttccgc ccgccgcgtg caaatcccgg tcgtggactt gtccgagccc       180
     gacgccgttt gcgcatcgat cgtccgcacc gcgtgcgact cgtgcgggtt cttccacgtc       240
     gttaaccacg gcgtggacga caatctcgcg ttcgacgtta ttcgatgggg cgccacgttc       300
     ttcgaccggc cgtgggacga taagatggcg ctggtccgcg gcgacatgag ggtctcacgg       360
     ggatacgaga tttcgcccga gcacatcgag gcgttggacc gggacgtgac ccgcgaagag       420
     gagctcgccg cgcgcgagcc ctccgccgcg cgtcgaatca tctccgagcg attctccgtc       480
     ggacccttcg acgtgccgaa cgactcgtac cacaccgacg aggagggcgc cctgttcttt       540
     cacccaaacg cctggcccga agattcaatc ccgtcgcttc gacccgcgat ggaggcgtac       600
     tatcgcgaga tggagtccct ctgcgcgcgg cttcaccgcg tcctggcgct ggccatgggc       660
     gcgccggccg acttcttcga ggacaagatc gacaaacact gctccaacct gcaggtggcc       720
     aactatccgt cgctggaccc gtcgcgttgg cgcgactctg atcgaatccc gcttcgaaaa       780
     aaatcgcacg cggatagcgg aacgctcacc gtgctgtggc gctcgccccc gaccgagggc       840
     actaagggcg ggctgcaggt gctggacgac acggcgggga cgtgggtgga cgtcccggtg       900
     ttgcccgggg ggaacgaacg ggaatccggg gcgcttctga ttaacctcgg gaaccagacg       960
     cagcgatgga ccgacggaaa gtgggtctcc acgaagcaca gggtcaccaa cccggacgtg      1020
     cacgcgccgg ggtacgcccc gtccagacgt ctgagcgtgg ccttcttcca caaggccaac      1080
     tacgacgccg tgatcgatca ccgagacttt gtgcccggtc gcgagaggga cgcgccgtcg      1140
     gtttcgtatc cgccggtgag gtccggggac gtgtcgaggg tgggcgcgct ccggcggctg      1200
     ggccggggcg tggacgcgag ggaggcgtcg atgcggtacc acgaggagct catgggggga      1260
     cgcgatcgcg cggaacgtgc ggcgggagag tccaccgcgg tgaaaattga cgcgagcgcc      1320
     gagaccgagg gggagcctcc gaagaagggg gagcctccga agaaggccga gcccgaggcg      1380
     gaccggtggg cgagcttgat ggacccgcgc ggccaggctg gaccgatatc cgcgggggac      1440
     ctgggtttag atcgaggggc cagcgccgag ggcgcggggg ccggtaacga taatccggcg      1500
     gcggggtgtc cggtgtgcag gggcacgggg tggaagccct gcgggcagtg cgggggaacc      1560
     gggatcaacc gggaggacct cttcgggggg aagttcaagg agggcgacac gtgctggctg      1620
     tgctccggga agaagaagac gatgtgcggc aactgcgtgg acctcaccga tagcttctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page