(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE201

MICSR_1.PE201        Location/Qualifiers
FT   CDS_pept        join(complement(407930..408135),complement(407540..407869),
FT                   complement(407212..407473))
FT                   /codon_start=1
FT                   /gene_family="HOG000029463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636541"
FT                   /orf_name="MICPUN_79669"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62122.1"
FT                   /db_xref="HOGENOM:HBG560053"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199AA59"
FT                   /db_xref="UniProtKB/TrEMBL:C1E178"
FT                   /transl_table=1
FT                   /translation="MLVREDDRQNRRGLRCFGWNKYGQAQGWDAPIDVVAVAAGERHSL
FT                   ALSAKGTVFAWGDNHTGQLGLGGEDPLPMDVPTTSLGRDVVIVGVAAGARHSVMVSATG
FT                   DVFTVGWGLYGQLGHEDAEDLFAPRRVEHLAGITVVSVAAGSAHTACVTRDGALYAWGS
FT                   NRKGELGTATGDVTKARESNDGAGSLAVAVACGSSHTVALARLESGEAGLFGFGWNNMG
FT                   QLGLGDDKDRGIPARIPLPANEKGKVTKLRCGWWHTVVGVEEY"
     atgctggtga gggaggacga caggcagaac cgacgcggcc tgaggtgctt cgggtggaac        60
     aaatacggcc aggcgcaggg atgggacgcg cccatcgacg tcgtcgccgt cgccgcgggg       120
     gagaggcact cgctggcgct ctccgcaaag ggcacagttt tcgcttgggg cgacaaccac       180
     accggccagc tcggcctcgg gggcgaggat ccgctgccca tggacgtgcc gacgacgtcg       240
     ttgggccgcg acgtcgtcat cgtcggcgtc gccgccggcg ccaggcacag cgtcatggta       300
     tccgccacgg gggacgtctt caccgtgggc tggggcctct acggccagct cgggcacgaa       360
     gacgcggaag accttttcgc cccgcgacgc gtcgagcacc tcgcggggat cacagtcgtg       420
     tccgtcgccg ccggaagcgc gcacaccgcg tgcgtcacca gagacggggc gctgtacgcg       480
     tggggcagta accggaaagg ggagttgggc accgccaccg gcgacgtgac caaagcgcgc       540
     gagtcgaacg acggcgcggg gagcctggcg gtggcggttg cgtgcgggag ctctcacacc       600
     gtggcgctcg cgaggttgga gagcggcgag gcgggtttgt tcgggtttgg gtggaacaac       660
     atgggccagc tcggtctggg ggacgataag gaccggggaa tacccgcgag gatccctctc       720
     ccggcgaacg agaaggggaa ggtgacgaag ctgcggtgcg ggtggtggca caccgtcgtc       780
     ggcgtcgagg agtactga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page