(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE202

MICSR_1.PE202        Location/Qualifiers
FT   CDS_pept        join(408660..408788,408884..410521)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636542"
FT                   /orf_name="MICPUN_56775"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61692.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E179"
FT                   /transl_table=1
FT                   /translation="MGKIPDTAAARKALKVAEIKALLEEAGLATDGTKPTLLERLEEHV
FT                   AKTDGDDGAEVAAPAAEPAPAPAAEPEAAAPEAAPEPVRDVPPPPVREVPPPPPAPAVA
FT                   KDDAKHEEDEEDGGEKWVLVAPAPTPLESLREMCAGCVSVEPLGGGPADGASTMALVEF
FT                   PAERDALNAVAALAALGHEAEIARRTLWQDDEDDADVTSTIVRVEGVSATIHESIVASV
FT                   FGTYGTCIAATREEGTDAFAVRMADRRGAETATAALSGVYRFEEGQEFPVRVTWCPCPS
FT                   KKSGGDRSSAAGEKRKRDEDVANGEGATLSAKQLLAVGLPATTQSGEQVAGWFAAEGGA
FT                   CTLFDKDRRCAILAFPTADAATEALDTHGGTLRPEGNPCPVTLRRIACDLDARPKKRSA
FT                   VQGPPPGVWPPVPKPGPEYGEPSAKIYIGSIPQEYAEDDVRRIFSTVGEVREVKILRNP
FT                   GDGRHKGSGFVTFSDIAATERAIHFIDNKYTLIAPAHPLQKPIYMKYAKIGRPSAAPQQ
FT                   PMVYQQPMAYQQPYYPPQQAYGHYPQHPQQAYAQYPQQAYGQYPQQGQAPQGPTHQQQQ
FT                   MWQQGFGGGAQQ"
     atgggtaaga ttccggacac cgccgccgcg cgcaaggcgc tgaaggtggc ggagatcaag        60
     gcgctgctag aggaggccgg cctggccacc gacggcacca aacccacgct cctcgagcgg       120
     ctcgaggagc acgtcgcgaa gaccgacggc gacgacggag ccgaggtcgc ggccccggcg       180
     gcggagcccg cgccggctcc agccgccgag cccgaggccg ccgctcccga ggcagccccg       240
     gagcccgtgc gggatgtccc gcctcccccg gtccgcgagg ttcccccgcc gcctccagct       300
     cccgccgtcg cgaaggacga cgcgaagcac gaagaggacg aagaagacgg gggcgagaag       360
     tgggtcctcg tcgccccggc gccgacgccg ctggaatccc tgcgcgagat gtgcgccgga       420
     tgcgtctccg tcgaacccct ggggggagga cccgcggatg gcgcctcgac gatggcgctc       480
     gtcgagttcc ccgccgagcg agacgccctc aacgccgttg ccgccctcgc cgcgctcggc       540
     cacgaggcgg agattgcgag acgcacgctg tggcaggacg acgaggacga cgcggacgtg       600
     acatccacga tcgtccgcgt cgagggcgtg tcggcgacga tccacgaatc gatcgtcgcg       660
     agtgtattcg gcacgtacgg gacgtgtata gcggcgacga gggaggaggg cacggacgcg       720
     ttcgcggtga ggatggcgga caggcgcggc gcggagacgg cgacggcggc gctgtccggg       780
     gtgtacaggt tcgaggaggg gcaggagttc cccgtgcgcg tgacgtggtg tccgtgtccg       840
     tcaaaaaaaa gcggcggcga ccggtcgtcg gcggcggggg agaagcgaaa gcgcgacgag       900
     gacgtcgcga atggagaggg ggcgacgctc tccgccaagc agctcctcgc ggtgggttta       960
     ccggcgacga cgcaaagtgg ggaacaggtg gctggctggt tcgcggcgga gggcggcgcg      1020
     tgtacgctct ttgacaaaga tcggcgatgc gccatcctcg cgtttccaac cgcggatgcc      1080
     gcgacggagg cgctggacac gcacggcggg acgctgcgac cggaggggaa cccgtgcccg      1140
     gtgacgctcc gaaggatcgc gtgcgacttg gacgcgaggc cgaagaagcg atccgcggtg      1200
     cagggtccgc cccccggcgt ctggcccccc gtgcccaagc ccgggcccga gtacggcgaa      1260
     ccctcggcta agatttacat cgggtccatc ccgcaggagt acgccgagga cgacgtgagg      1320
     cgaatcttta gtacggtggg cgaggtgcgg gaggtgaaga tcctccgaaa tcccggagac      1380
     gggaggcaca aggggagcgg gttcgtcacg ttcagcgaca tcgcggcgac ggagcgggcg      1440
     attcacttca tcgacaacaa gtacacgctc atcgcgccgg cgcacccgct gcagaaaccg      1500
     atctacatga agtacgccaa gatcggccga ccctccgcgg cgccgcagca gccgatggtg      1560
     taccaacagc cgatggcgta tcagcaaccc tattacccgc cccagcaggc gtacggacac      1620
     tatccccagc atccccagca ggcgtacgcg cagtacccgc agcaggcgta cgggcagtac      1680
     ccgcagcagg gccaggcgcc gcagggaccg acacatcagc agcagcaaat gtggcagcaa      1740
     ggtttcggcg gcggcgcgca gcagtga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page