(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE203

MICSR_1.PE203        Location/Qualifiers
FT   CDS_pept        join(complement(411957..412022),complement(411640..411669),
FT                   complement(410691..411245))
FT                   /codon_start=1
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636543"
FT                   /orf_name="MICPUN_56776"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62123.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E180"
FT                   /transl_table=1
FT                   /translation="MPRGKKKEPEPEPEENEVMEDAAVEDDDEESAELEEMKKRLAAME
FT                   EEAQKLKDEANAIGDDMNTGDGASGAADADRAEADSRSVHVGGVDYATTPEELAKHFEA
FT                   CGTVNRVTILTDKYDNPKGFAYVEFLEADAVQNAIKLTDTEIHGRKLRVSAKRTNVPGM
FT                   KQGGRGRGGRGGRGFNPYGMMMMPMMMPHMFGGRGRGRGRGGRGGRGGRGAPY"
     atgccccgcg gaaagaagaa ggaacccgag cccgagcccg aagagaacga ggtcatggag        60
     gacgcggccg tcgaggatga cgacgaggaa tcagcggagc tcgaagaaat gaagaagagg       120
     ctcgccgcca tggaggagga ggcccagaag ctcaaggacg aggctaacgc catcggcgac       180
     gacatgaaca ccggcgacgg cgcctcgggc gccgccgacg ccgatcgcgc cgaggctgac       240
     tcccgctctg tccacgtcgg aggcgtcgac tacgccacca cgccggagga gctcgccaag       300
     cacttcgagg cgtgcggcac cgtcaaccgc gtcaccatcc tgaccgacaa gtacgacaac       360
     cccaaggggt tcgcgtacgt cgaattcctc gaggcggatg cggtgcaaaa cgcgatcaag       420
     ctgacggata ccgagatcca cggccgaaag ctcagggtgt cggccaagcg aaccaacgtg       480
     cccgggatga agcaaggcgg gcgcgggcgc ggcggccgcg gcggccgcgg gttcaacccc       540
     tacggcatga tgatgatgcc gatgatgatg cctcacatgt ttggaggcag gggaaggggc       600
     agaggtcgcg gcggccgcgg aggacgcggc ggccgcggtg cgccgtatta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page