(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE204

MICSR_1.PE204        Location/Qualifiers
FT   CDS_pept        complement(412297..413073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636544"
FT                   /orf_name="MICPUN_56777"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62124.1"
FT                   /db_xref="UniParc:UPI000199AA5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E181"
FT                   /transl_table=1
FT                   /translation="MTLLTANSSIASRVRAPRASVRSRASSLRESLSGGWNIRRIVRAD
FT                   IAARDRRGGRVATAVRAADDGNFLDKLNPFKAMEKAKEKNAIAKREKEANQVINDDMRK
FT                   QLFGDGLGGRMLQGMVNNVAGALKEQMGAAAAASQETYDAAERAVRSDPKMRAALGDGI
FT                   RCTPPMSQMSSSQNVNGVQTQATTIVFIAQGSNGRQAQVQATGTGGGDQELRLDISGML
FT                   DTGEVVKVDGMGGGSMADGVFDVEAKTIDDDDVIDV"
     atgacgctct tgacggcgaa ctcttcgatc gcatctcgcg tccgcgcgcc ccgcgcgtcg        60
     gttcgctcac gcgcgtcgtc cctccgcgaa tcgctctcgg gcggttggaa cattcgccga       120
     atcgttcgcg ctgacatcgc cgctcgagac cgccgcggcg gacgcgtcgc gaccgccgtc       180
     cgcgccgccg acgacggcaa ctttctcgac aagctcaacc cgttcaaggc gatggagaag       240
     gccaaggaga agaacgcgat cgccaagcgg gagaaggagg cgaaccaggt catcaacgac       300
     gatatgcgga agcaactgtt tggggacggg cttggcggcc ggatgctcca gggaatggtc       360
     aacaacgtcg cgggggcgct gaaggagcag atgggcgccg ccgcggccgc gtcgcaggag       420
     acgtacgacg ccgccgagcg cgccgttcgc tccgacccga agatgcgcgc ggcgctgggc       480
     gacggcatac gctgcacgcc cccgatgtcg cagatgagct cgagccaaaa cgtaaacggc       540
     gtgcagacgc aggccaccac gatcgtgttc atcgctcagg ggagcaacgg gaggcaggcg       600
     caggtgcagg ccacggggac gggcggtggg gaccaggagc tcaggttgga catcagcggg       660
     atgctcgaca ccggcgaggt ggtcaaggtg gatgggatgg gcggcggttc aatggcggat       720
     ggcgtctttg acgtagaggc gaagacgatc gacgacgacg acgtcataga cgtgtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page