(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE205

MICSR_1.PE205        Location/Qualifiers
FT   CDS_pept        413551..416436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636545"
FT                   /orf_name="MICPUN_56778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61693.1"
FT                   /db_xref="UniParc:UPI000199AA5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E182"
FT                   /transl_table=1
FT                   /translation="MEEAIAAAEATLEALVKAAEDFAVPLIAEQRAVLAAADAKAADAA
FT                   SPARDAFETVRAEFEKKIDELDGALTSAVEKERAEIAVVARAAREDPFAEDEDADVATI
FT                   VASVFDPAREHLGERLRNSRSAAEKMLQWLERRAPDLDRAATDAASKAADAGDGIDDDS
FT                   GKHEDWAADEESDLEDLPPLGGDWAEDDEDDLPPLEGEWQKDAEAGPSPTPPSPKKKPA
FT                   AFKPRDASPPRGNAWGHAPPAHGRDRSDAGHRMGPAAGRDVDLRDRLGGGGSRDYGGDR
FT                   RSSFDRGGDYGRDRGGGGFRDSWGAPGGGYRDDRRGGGGGGGGHRSEYIERMERKYGRV
FT                   DDGPPPRSTMRDRSPPKPPPEVHYPTRDEQRAEAKAREERAAWRLATRPLKEFFANAKK
FT                   GEGISPSTIRELLNELSEPPFAEGRLAPNARKAFELVAASAKETGSKRTFEEVEELVRG
FT                   VVNPLYHLLTYGVKAPGAEGGGPPSSVAETIAEQMHTAAVKLLAASLDILSKGDATKKA
FT                   VESAKGIVIVREQVAAKLAGRAPGGGRGDKETTVTRRDSVDGRGHGKGSAANKPAQASG
FT                   TDADRWDRKKDGRPTPSPEVYRAPRGGEKGVGVMARLGDKNDSSSPANGVKPRAVPKVV
FT                   IHRPFSEGKQRELTPSPAQQGQGERGGKPKPSPTPPQQGQKLSPFERGPASAASQALGK
FT                   SPPSARGGVFARLEGKPKLQGLGKSDLPAPKPDAAKELPHPKSTEKELPHPKRVVVVHK
FT                   PNEPNDHKELPHPKPAPKPRDPPAPPAKGARGDKEKPAKQRDALDDALDEELAKATKGK
FT                   KGGRTKGGSDRQGAPSEPHKELPHPKPAAPAPGSEKPHPVPAPRPVSAPDSESAKQLPH
FT                   PNKPPVPKGNNGRSPIPAPKPATNTNTGGSSVGGRPGSGKARNESASPPPPKERDELDD
FT                   VLDAELEKAMGGGGGGKRRPRGGRGSRGGGK"
     atggaggaag cgatagcagc cgccgaggct accctcgagg cgctggtgaa ggctgccgag        60
     gacttcgcgg ttccgctcat cgcggagcag cgcgcggtgc tcgcggccgc cgacgcaaag       120
     gcggccgacg cggcgtctcc cgcgcgcgac gcgttcgaaa ccgtccgggc cgagtttgag       180
     aaaaagatcg acgagctcga cggcgccctc acctccgcgg tggagaagga gcgcgccgag       240
     atcgccgtgg tggcccgagc cgctcgcgag gatccattcg ccgaggatga agacgcggat       300
     gtggccacca tcgtcgcgtc cgtcttcgat ccagcgcggg aacacctcgg cgagcggctc       360
     agaaactcga gatcggcggc cgagaagatg ctgcagtggc tcgagcggcg cgcgccggac       420
     ctcgaccgcg ccgcgaccga cgccgcgtct aaggccgccg acgccgggga tgggatcgac       480
     gacgactccg gcaagcacga ggactgggcc gcggacgaag aatccgacct ggaggatctc       540
     cccccgctcg gcggggattg ggccgaggac gacgaggacg acctgccccc gctcgagggc       600
     gagtggcaga aggacgccga ggcgggcccg agcccgaccc caccgtcccc gaagaagaaa       660
     cccgcggcgt tcaaaccacg agacgcctcg ccgccgagag gcaacgcgtg gggacacgcc       720
     cccccggctc acggccgcga tcgatcagac gccggacatc ggatgggtcc cgccgcgggc       780
     cgcgacgtag acctccgcga tcggctgggc ggcggcggat cgcgcgacta cggcggcgac       840
     cgccgctcgt cgttcgaccg cggcggggat tacgggcgcg atcggggcgg gggaggcttc       900
     cgggactcct ggggcgcgcc gggtggcggg tatagggacg accgacgcgg cggcggcggc       960
     ggcggcggcg ggcacagatc cgagtacatc gagcgcatgg agaggaagta cgggcgcgtg      1020
     gacgacggtc cgccgcctcg ttctacgatg agggatcgat cgccgccgaa accgccgccc      1080
     gaggtgcatt accccacccg cgacgagcag cgagcggagg ctaaggctcg ggaggaacgc      1140
     gccgcgtgga ggctggccac gcgaccgctc aaggagttct tcgccaacgc gaagaagggc      1200
     gagggtatct ccccgtccac gatccgcgag ctgctcaacg aactctccga accccccttc      1260
     gcggaggggc gactcgcgcc caacgctcgg aaagcgtttg aactcgtagc cgcgtccgcc      1320
     aaggagacgg gcagcaagcg aaccttcgag gaggtcgagg agctcgtgcg aggggtcgtc      1380
     aacccgctgt atcacctgct cacctacggc gtcaaggctc ccggcgccga gggcggtggg      1440
     ccgccgtcct ccgtggcgga gacgatcgcc gagcagatgc acacggcggc ggttaagctc      1500
     ctcgccgcgt cgctggacat cctgtcaaag ggtgacgcga ccaaaaaggc ggtggaatcg      1560
     gcgaagggaa tcgtcatcgt gcgcgagcag gtggccgcga agctcgccgg ccgcgccccg      1620
     ggcggcggca ggggagacaa ggagaccacc gtgacgcgcc gagattccgt cgacggaagg      1680
     ggccacggca aggggtccgc cgccaacaaa ccggcgcagg cgagcggcac ggacgccgac      1740
     cggtgggacc gcaagaagga cggtcgcccg acgcccagcc cggaagtgta ccgcgctccc      1800
     aggggcggcg agaaaggcgt cggcgtgatg gccaggctcg gcgacaagaa cgattcgtcg      1860
     tccccggcca acggcgtcaa gcctcgcgcg gttcccaagg ttgtcataca ccggcccttc      1920
     tccgagggta agcagcgcga gctcacgccg tcgccggcgc agcagggaca gggagaacgg      1980
     ggcggaaagc ccaagccgtc gcccaccccg ccgcagcagg ggcagaagct ctcgccgttc      2040
     gagcgcggcc cggcttccgc cgcgagtcag gcgctgggca agtcgccccc gagcgcgaga      2100
     ggcggcgtgt tcgctcggct cgagggcaaa cccaagctcc agggtttggg caagtccgac      2160
     ctacccgcgc ccaagccgga cgccgccaag gagctgccgc atcccaagtc cacggagaag      2220
     gagctgccgc atcccaagcg cgtcgtcgtc gttcacaagc cgaatgagcc gaacgaccac      2280
     aaggagttac cgcacccaaa gccggctccg aagccaaggg atccgcccgc gccccccgcc      2340
     aagggcgccc ggggcgacaa ggagaaaccc gccaagcaga gggacgccct cgacgacgcc      2400
     ctcgacgagg agctcgcgaa ggcgacgaag ggaaagaagg gcgggcgcac caagggcgga      2460
     tcggaccgcc aaggagctcc gagtgagccg cacaaggagc tcccgcatcc caagcccgcc      2520
     gcgcccgccc ccggctctga gaaaccgcac ccggtcccgg cgcccaggcc ggtgtccgcg      2580
     ccggactccg agtccgccaa gcagctcccg cacccgaaca agcccccggt gcccaaaggg      2640
     aacaacgggc ggtccccgat cccggcgccc aagcccgcga caaacacaaa cacgggtgga      2700
     tcgtcagtcg gcggccggcc ggggtcgggg aaggcccgca acgagtcggc gtcgccgccg      2760
     ccccccaagg aacgcgacga gctggacgac gtgctagacg ccgagctcga gaaggcgatg      2820
     ggcggaggag gcggaggtaa gcggcgacct cgcggcgggc gcgggtccag gggtggcggg      2880
     aagtga                                                                 2886
//

If you have problems or comments...

PBIL Back to PBIL home page