(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE206

MICSR_1.PE206        Location/Qualifiers
FT   CDS_pept        complement(416531..417379)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636546"
FT                   /orf_name="MICPUN_107887"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62125.1"
FT                   /db_xref="UniParc:UPI000199AA5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E183"
FT                   /transl_table=1
FT                   /translation="MAPRMMHPRVGTGEPDPEEDESEEEKKDGILIPLLTFFGFVFVFI
FT                   PITVMLMGAIFGLILAEVEGWKIKDGFYYIISMLCGLPTPLTEVDPDTDEGKLVDVIVA
FT                   LWALALAGTIIGVVGGLSVINRLVDAAESFGQRFKRAARKAVTGSDEEAPAAADEDGEE
FT                   KPVSLTLNVLTFLVFIFIVIPIVIILVAVLFGFILAEVEGWKIKDGFYYIISMLCGLPN
FT                   PLTDVTPDSDEGKIVDIIIALWALSLAGTIIGIVGGMSVINTLVESAEALGERFGKKKE
FT                   N"
     atggctcctc gcatgatgca tcctcgagtg ggcaccggcg aacccgatcc cgaggaggac        60
     gagtccgagg aggagaagaa ggacggcatt ctcatcccgc tgctcacgtt tttcggattc       120
     gttttcgtct tcattccaat cacggtcatg ctcatgggcg ccatcttcgg cttgatcctc       180
     gccgaggtgg agggatggaa gatcaaggac ggcttctact acatcatctc catgctctgc       240
     ggcctgccca cgcccctgac cgaggttgat cccgacacgg acgaaggcaa actcgtcgac       300
     gtgattgtcg cgctgtgggc gctcgcgctc gcgggcacga taatcggcgt ggtcggcggt       360
     ctgtccgtca tcaaccgcct cgtcgatgcg gcggagagct tcggccagag gttcaagagg       420
     gccgcgagga aggccgtgac cggatcggac gaggaggctc cggccgccgc cgatgaggac       480
     ggtgaggaga agccggtcag cctaacgctc aacgtcctca cgttcctggt cttcatcttc       540
     atcgtcatcc ccatcgtcat catcctcgtc gccgtcctct ttggcttcat cctcgccgag       600
     gtggagggat ggaagatcaa ggacggcttc tactacatca tctccatgct ctgcggcctg       660
     cccaacccgc tcaccgacgt cacgccagac tcggacgaag gcaagattgt ggacatcatc       720
     atcgcgctgt gggccctctc cctcgccggt accatcatcg gcatcgtcgg aggcatgtcc       780
     gtgatcaaca cgctcgtcga aagcgccgag gccctgggcg agaggttcgg taagaagaag       840
     gagaactga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page