(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE207

MICSR_1.PE207        Location/Qualifiers
FT   CDS_pept        complement(417583..418845)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636547"
FT                   /orf_name="MICPUN_56780"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62126.1"
FT                   /db_xref="UniParc:UPI000199AA5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E184"
FT                   /transl_table=1
FT                   /translation="MAPVPPALFKARGTTLRADEYLRGVNPVGTVHRGPLSAFGRQEIS
FT                   ALRTEPSVAFSRTDRLEAIRPFSIEYFLPGEGNRAYAASHAREYLARHEAEGLDRFARP
FT                   AVSEPPEPRWKTFGRSGTHHDFAKTQARGGHLPLKPDWPNKNESRWGAAERLHRPLDGG
FT                   HDLVQYSSFARQRLSTHANSPKAYVDIGAATTRAERGRQTLGRAHDERSAALGACSPGP
FT                   QVPRDRDGFALGAVGRQIEAGRVTEPRAVVGSNSRVTAPTWAPAGVKGGDWTRPVRPDP
FT                   SVPGPGAYHETFDFRRTRGERGNGDGSGRRSTGRRTHRQLITGEAAIADERERRLASSF
FT                   NPKDAGAYWGSSGRGTLPSLSSSSSPAVPPLGSLGGGSPARTYPVSGKEIRARTRSGRW
FT                   TPRDEQRGRARRLLGRASPAP"
     atggctcccg tgccccccgc gctgttcaag gcccggggaa ccaccctgcg cgcggacgag        60
     taccttcgcg gcgtgaaccc cgtgggcacc gtccaccggg gcccgctcag cgcgttcggg       120
     cgtcaggaga tcagcgcgct tcgcaccgaa ccctccgtcg cattttcccg caccgaccga       180
     ctggaggcca tccgaccgtt ctccatcgag tacttcctcc cgggcgaggg taacagagcc       240
     tacgcggcat cgcacgcgcg cgagtacctc gccaggcacg aggcggaggg cctggaccgg       300
     ttcgccaggc ccgcggtgag cgagcccccg gagccgcggt ggaaaacctt tggcaggtcg       360
     gggacgcacc acgatttcgc caagacgcag gctcgcggcg gccatctccc gctcaagccc       420
     gactggccca acaagaacga gtcgcggtgg ggcgccgccg agcgcctgca cagacccctc       480
     gacggcggcc acgacctcgt ccagtacagc agcttcgcga ggcagaggct gagcacgcac       540
     gcgaactcgc cgaaagcgta cgtcgacatc ggcgccgcca ccacccgcgc cgagcgaggc       600
     cgccagaccc tcggacgcgc ccacgacgag cgctccgccg ccctcggcgc gtgcagcccc       660
     gggccgcagg tcccgcgcga cagggacggg ttcgctttgg gcgccgtcgg ccggcaaatc       720
     gaagccgggc gggtcaccga gccgagagcc gtggtgggat ccaactcgag ggtcaccgcg       780
     ccgacgtggg cgcccgcggg ggtcaagggc ggggactgga ccaggccggt gcgtccggac       840
     ccgagcgtcc cggggccggg tgcgtaccac gagacgttcg atttcaggcg aacgcgcggg       900
     gagcggggaa acggggatgg atcgggacgt cgatcgacgg ggaggaggac gcatcgtcag       960
     ctgattacgg gggaagcggc gattgcggat gagagggagc ggcgattggc ttcgtcgttc      1020
     aacccgaagg atgccggcgc gtactggggc tcgagcgggc gcgggacgct tccgtcgttg      1080
     tcgtcgtcgt cgtcgccagc tgtgccgccg ctcggaagcc tgggtggtgg gtctccggcg      1140
     cgaacgtacc cggtgagcgg gaaagagatt cgcgcgagga cgaggagcgg tcggtggacc      1200
     ccgcgagacg aacagagggg ccgggcgagg aggctcctcg ggcgggcgtc gccggcgcca      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page