(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE208

MICSR_1.PE208        Location/Qualifiers
FT   CDS_pept        419146..419886
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636548"
FT                   /orf_name="MICPUN_56781"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61694.1"
FT                   /db_xref="UniParc:UPI000199AA60"
FT                   /db_xref="UniProtKB/TrEMBL:C1E185"
FT                   /transl_table=1
FT                   /translation="MALVVTPTLASIAPAGRPSLGRSRGGTGAMTLPRPSTSSPRQPAK
FT                   PVGRSGRSSRGSIQVAASPLPIADVAALFDNPFSKAAEEVDSSLPGWFPALSFIAYVLV
FT                   LREVRRIRQREERKAREKMAKAAQEAAQRKVESMGPEVWGKLIVCLVIDALGDSSFLLP
FT                   GLGEGTDIAYAPLEAFLLSQLFRSNVVSGVGFVEEALPFTDVIPTATLAWMTETFFSDT
FT                   WPGRALGLGGDKPVEKEKDEKKDK"
     atggcgctag tcgtgacccc gaccctcgcg tcgatcgcgc ccgcgggacg cccatcactc        60
     gggcgctcgc gcggcggcac cggcgcgatg acgctccccc gtccgtcgac gtcgagccct       120
     cgccaaccgg cgaaacccgt cggaaggagc gggcgatcgt ctcgaggaag catccaggtc       180
     gcggcgtcgc ccctcccgat cgccgacgtc gcagccctgt tcgacaaccc gttcagcaag       240
     gccgcggagg aggtcgactc cagccttccg ggctggttcc ccgcgctctc gttcatcgcg       300
     tacgtcctcg tcctgcgcga ggtcaggcgg atcaggcaga gggaggagcg caaggcgagg       360
     gaaaagatgg ccaaggctgc gcaggaagcg gcgcagcgca aggtcgagtc catggggccc       420
     gaggtgtggg gtaagctgat cgtgtgcctc gtcatcgacg cgctcgggga ctcgtcgttc       480
     ctgctgcccg gcctgggcga ggggacggac atagcgtacg cgcccctgga ggctttcctg       540
     ctgtcgcagc tgttccgcag caacgtggtg tcgggcgtgg gtttcgtgga agaggcgctg       600
     ccgttcacgg acgtgatacc gacggcgacg ctggcgtgga tgacggagac gttcttcagt       660
     gacacctggc cgggcagggc tctcggccta gggggcgaca agccggtcga gaaggagaag       720
     gacgagaaga aggacaagta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page