(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE209

MICSR_1.PE209        Location/Qualifiers
FT   CDS_pept        join(complement(420044..421005),complement(419946..419955))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636549"
FT                   /orf_name="MICPUN_56782"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62127.1"
FT                   /db_xref="UniParc:UPI000199AA61"
FT                   /db_xref="UniProtKB/TrEMBL:C1E186"
FT                   /transl_table=1
FT                   /translation="MRTRPAFGRCDCAGSDRGWEVAGGYTSEASHVRRSPTPDGNSLLG
FT                   GVAQLCHAFFHCSPTPELSSHPDELCLRVACDPAGRKCETKGVVVVAALRDRAGDLRFL
FT                   SRYSNCPLSSHAEEYVVRDEELVRAVMEMAPEDDARSSTKTPGSAGTLTLYQRLQPCHG
FT                   SSDNRGPLWSCSDALVAGLHRELLGPRGVSLRVAVSYTYRAHWDVRGFESERERRWWGP
FT                   KVEAAREGIRVFAAAAKDGVTLEALNAEDWAFLVSLCDEDVARDYAAAFGEGGEGFGSK
FT                   GCGVFTAPAVAHRRAMDEFVAEQIRRHSASGPTNGRATNAAG"
     atgcgcacgc ggcccgcgtt cgggcggtgc gactgcgccg gtagcgaccg cgggtgggag        60
     gtcgccggag ggtacacctc cgaggcgtct cacgtgagaa ggagcccaac cccggacggg       120
     aactccctcc tcggcggcgt cgcccagctg tgccacgcgt tcttccactg ctccccgacc       180
     ccggagctgt cgtcgcaccc cgacgagctg tgcctgcgcg tcgcgtgcga cccggcgggg       240
     cgaaagtgcg agaccaaggg cgtggtggtc gtcgccgcgc tgcgggatcg agccggggac       300
     ctcaggttcc tctccaggta ctccaactgc ccgctctcgt cccacgccga ggagtacgtc       360
     gtccgcgacg aggagctcgt ccgagcggtc atggagatgg cacccgagga cgacgcgcga       420
     tcgtccacca aaaccccggg ctcggcgggc acgctcacgc tgtaccagcg cctgcagccg       480
     tgccacggaa gctccgacaa ccgaggaccg ctctggagct gctcggacgc gctcgtcgcc       540
     gggctccacc gcgagctgct cgggccccgg ggggtgtcgc tgcgcgtggc ggtgagctac       600
     acgtacaggg cgcactggga cgtgcggggg ttcgaatccg agcgcgagcg aaggtggtgg       660
     ggtccgaagg tggaggcggc tcgagagggc atacgggtct tcgccgccgc agcgaaggac       720
     ggggtgacgc tcgaagcgct gaacgcggaa gactgggcgt ttctcgtcag cctgtgcgac       780
     gaagacgtgg ccagggacta cgcggcggcg ttcggtgaag ggggcgaggg ttttgggtcg       840
     aaagggtgcg gcgtgttcac ggcgccggcg gttgcgcaca ggcgagcgat ggacgagttc       900
     gtcgccgagc agattcggag gcactcggcg tcggggccga cgaacgggcg cgccacgaac       960
     gccgccggtt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page