(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE211

MICSR_1.PE211        Location/Qualifiers
FT   CDS_pept        complement(422784..423821)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636551"
FT                   /orf_name="MICPUN_56784"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62128.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AAC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E188"
FT                   /transl_table=1
FT                   /translation="MSLLARTSRAAFSFLGSSQGTRALRLASTAAPPRGHHLHTAPRHL
FT                   PASHLARPSTAPSFATRAMSSGNDQATTHVPPAPGVSKLYAAEPVAGRCALITGASSGI
FT                   GQATAERLAELGCRLVVAARRKDRLDALATRLANDFGAKVHCVALDVTDVDAVMSLPSA
FT                   LPAEFADVSILVNNAGGALGTAKCTENNMDDVATMLDANVKGVVACTRAFSPGMVERGC
FT                   GHVVNISSIAGVEWYGGGSVYCATKAAINAFTYASRKDLHDTPCKITSVSPGFVNTEFA
FT                   TVRFKGDKGKADNVYAGMKYGGPLLAEDIADNIVYALTRPGRVQVCDMLVYPTCQASAR
FT                   DIARE"
     atgtctctcc tcgcgaggac ctctcgcgcc gcgttcagct tcttgggatc gtcccaaggc        60
     acccgcgcgc tccgcctcgc gtccaccgcc gctccaccgc gcggtcacca ccttcacacc       120
     gccccgcgcc acctcccggc gagccacctc gcgcgcccct ccaccgcgcc ctctttcgcg       180
     acgcgcgcaa tgtcctctgg caatgaccaa gcgacgacgc acgtcccccc cgcgcccggc       240
     gtgagcaagc tctacgccgc cgagcccgtc gccggcagat gtgccctgat caccggcgcg       300
     tccagcggca tcggccaggc caccgcggag aggctcgccg agctcggatg ccgcctcgtc       360
     gtcgccgcgc gacggaaaga tcgcctcgac gcgctcgcga cgaggctcgc gaacgacttc       420
     ggagcgaagg tccactgcgt cgcgctggac gtcaccgacg tcgacgcggt catgtctctc       480
     ccgtcggcac tccccgcgga gttcgcggac gtctccatcc tggtcaacaa cgcgggcggc       540
     gcgctgggca ccgccaagtg caccgagaac aacatggacg acgtcgccac catgctggac       600
     gccaacgtga aaggggtcgt cgcgtgcacc agagccttct ccccggggat ggtggagcgc       660
     gggtgcgggc acgtggtgaa catctcgtcc atcgcgggcg tcgagtggta cggcggcggg       720
     tccgtgtact gcgccaccaa agccgcaatc aacgcgttta cgtacgcgtc cagaaaggac       780
     ctccacgaca cgccgtgcaa gatcacgtca gtgtccccgg gcttcgtcaa caccgagttc       840
     gccaccgtgc ggttcaaggg ggacaagggc aaggcggaca acgtgtacgc ggggatgaag       900
     tacggcggcc cgttgctggc ggaggacatc gcggataaca tcgtgtacgc gttgaccagg       960
     ccggggcggg tgcaggtgtg cgacatgctc gtttacccca cgtgccaggc gtccgcgagg      1020
     gacatcgcgc gggagtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page