(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE212

MICSR_1.PE212        Location/Qualifiers
FT   CDS_pept        424141..428529
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636552"
FT                   /orf_name="MICPUN_56785"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /protein_id="ACO61696.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199AAC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E189"
FT                   /transl_table=1
FT                   /translation="MVVATASGDGFAPHKGALDTAARAAETMWWWDPADRADRAKDGGG
FT                   APGKTKGVVASGARAGAWRTRDELVPAGSGVKTPTPARDRARWTPWDELVDCSEAPYFR
FT                   WFAGAKTNAAFNAVDRHVLDGRGDDCALTTLPEEEDPKAGVDGARLSVTRRELLGAVAA
FT                   AARDLRDRHGVKPRDRVLFHMPTDATHFAYMLACQRLGAAYSATAVDSVEGVLASRTAD
FT                   LAPKLVIAYAEPVVHGGQPVDCAAKLRSALDALNREGSEGSEPTGRGNEQSKGNKRTKK
FT                   ASSNDVDPKSKVPKTNVPAPALVLLPRWGAKKNVASAGAAQFRSLRDEDAFKSAQKICA
FT                   CEPCDSDHPLFVSYTSGSTGKPKGVVHGHGGYVSGVLQSMTTVFECAPGEGGDGVKGGI
FT                   LTVGSAGWITGQSYMLMGPLLAGVRSVVMVGSPVYPTPLRMIRAVESEGCTLLKTGSAV
FT                   VRQLMTDPSNAAKVDAIDTSTLRCATFCAEPVSVEVHKYSHDHITDKFINSYWATEHGA
FT                   MVFSRDVAAPNGLTARGVIKSDARTWPLPWVSAALDSESSDVVIAGPYPSLALTVFGDV
FT                   QNVYDQNWRGDFAKYKETYWPKDGGGFVQGDVARASGEKGGGFTFHGRSDEVINVNGNR
FT                   VGTEQIERCLWNLEADGYGVKDCAVVGAPDFVKGTTPVAFVVFEPLARGGKKRKVGAGA
FT                   PDLAAFKSAAATAVGDKVGSYAAPDHIFAVNALPKTITNKTARKTLQMLLAGGEPPSGN
FT                   LARAEVLPPIAEAVAEWRLTAATTTSTIDLGKYWRRYTMDDHNIQGRAIVPGAGWLALI
FT                   AHEAGTSKLADVAFMRGVFEPDTTIRVVKRRRLMQATAGEETILKASLVSGDAAPETIG
FT                   PDVFGRGVALGSPSKKKPARGKENGVEENSVADNGVEQSDASRNKNAEAVGVKITDDSN
FT                   HEQHYRRCSALRLEYGGAYRAIERVAWSGHAFRAECFPRTHLAAVLDAGLQVVCASVRA
FT                   NTFIPVAVADFQITEGVDAFDESRRCVVHGEILEQYPEFLVADLRYEYEGVQGSSGVQG
FT                   SKSGGVQGSSGKKKKKASVVSSSSAAAATTGNGVFASMGRARFARVEGTKPRLQPTKAK
FT                   EANPTASPFGSQTLDPKTALARLRQLTTEQRVDAVRSVIGSIVSDLTDADVDFSKTVFD
FT                   NGMHSLNAVELLSRLNQTLGTGVTTKLVVNDAPMADFAVAVAEHATTFESTADDPNAKP
FT                   FPNVDYANLNEIVRRRLAGKTVGNTPYWFLFKYITYNFWKKSFQFFRIGGHKFLMNPPR
FT                   EIDLSLEVRMDRVVEFRDVDMNQHYTVEMIVARSVDGVEQLMAKSGLTHIEHYYRRNLF
FT                   AAKIQSTFHKELAHGDRYVIKTKITKVTGSLMDIRVAFLDPDDVLCFEILWTILIVLDS
FT                   NERLLLDWENVDLMDSGRRLIAGPGKGRAEAPTSASKGLKSSSKPSSVAGVESGRTIHT
FT                   K"
     atggtcgtcg cgaccgcctc cggcgatggc ttcgcgcccc ataagggcgc gttggacacc        60
     gcggcgcgcg cggcggagac gatgtggtgg tgggaccccg cggatcgcgc ggaccgcgcc       120
     aaagacggag gaggggcacc cggcaagacg aagggcgtcg tcgcctcggg cgcgcgcgcg       180
     ggggcgtggc gcaccaggga cgagttggtc ccggccgggt ccggagtcaa gaccccgacg       240
     cccgcgaggg atcgcgctcg ctggacgccc tgggacgagc tcgtggactg ctccgaggcg       300
     ccctactttc gatggttcgc gggcgccaag accaacgcag ccttcaacgc ggtcgatcgg       360
     cacgtcctcg acggccgcgg cgacgactgc gccctgacca cgctgcccga ggaggaggac       420
     ccaaaggcgg gcgtggacgg cgccaggctc agcgtcacca ggcgcgagct cctcggcgcc       480
     gtcgccgccg ccgcgaggga cctccgggat cgccacggcg tcaagcccag ggatcgcgtc       540
     ctcttccaca tgcccacgga cgcgacccac ttcgcgtaca tgctcgcgtg ccagcgcctc       600
     ggcgcggcgt acagcgccac cgccgtggac agcgtcgagg gcgtcctcgc gtcgagaacg       660
     gcggacctcg cgcccaagct cgtcatcgcc tacgccgagc ccgtcgtcca cgggggacaa       720
     ccggtggatt gcgcggcgaa gctccgatcg gcgctcgacg ccctcaaccg cgagggaagc       780
     gagggaagcg aaccgactgg gcgtgggaac gaacaatcca aggggaataa gaggacgaag       840
     aaggcgtcgt cgaacgacgt ggatccaaaa tccaaggtgc caaagacgaa cgtacctgcc       900
     cccgcgctgg tgctgttgcc caggtggggc gcgaagaaaa acgtcgcgtc ggcgggggcg       960
     gcgcagttcc gctctttgcg cgacgaggac gcgtttaaat cggcgcagaa gatctgcgcg      1020
     tgcgagccgt gcgacagcga ccacccgctc ttcgtgtcgt acacctcggg cagcacgggc      1080
     aagcccaagg gggtggtgca cggccacggg ggctacgtct ccggcgtgtt gcagtcgatg      1140
     acgacggttt tcgaatgcgc gccgggcgag gggggcgacg gcgttaaggg cgggatcctc      1200
     acggtgggct ccgccggttg gatcaccggt cagagctaca tgctcatggg cccgctgctc      1260
     gcgggggttc gatcggtcgt gatggtgggc tcgcccgtgt atcccacccc gctgcgcatg      1320
     atccgcgccg tggagagcga ggggtgcact ctgctcaaga cgggcagcgc ggtggtgagg      1380
     cagctcatga cggacccgag taacgcggcc aaggtggacg ccatcgacac ctcaaccctc      1440
     cgatgcgcca cgttctgcgc cgagcccgtc tccgtcgagg tgcacaagta ctcgcacgat      1500
     cacatcaccg acaagttcat caacagctac tgggccaccg agcacggcgc catggtgttc      1560
     tccagggacg tggccgcgcc gaacggcctc acggcgaggg gcgtcatcaa gtcggacgcg      1620
     aggacgtggc cgcttccgtg ggtctccgcc gcgctcgact cggagtccag cgacgtggtc      1680
     atcgcggggc cgtacccgtc gctcgcgctc accgtctttg gagacgttca aaacgtttat      1740
     gaccaaaatt ggcgcggaga ttttgccaag tacaaagaga cgtactggcc aaaggacggc      1800
     ggcggtttcg tgcagggcga cgtggcgcga gcctcgggtg agaagggcgg cgggttcacc      1860
     tttcacggca ggtctgacga ggtgatcaac gtcaacggca accgcgtggg cacggagcag      1920
     atcgagcggt gcctctggaa cctcgaggcg gacgggtacg gcgtgaagga ttgcgccgtg      1980
     gtgggtgccc cggactttgt caagggaacc acccccgtcg cgttcgtggt gttcgagccc      2040
     ctcgccaggg ggggtaagaa gcgcaaggtg ggcgcgggtg cacccgatct cgccgccttt      2100
     aagtccgcgg ctgccaccgc ggtgggcgac aaggttggat cttacgccgc ccccgaccac      2160
     atcttcgcgg tgaacgcgct gcccaagaca atcaccaaca agacggcgcg aaagacgctt      2220
     cagatgctcc tcgcgggcgg tgagccccct tccggtaacc tcgccagggc tgaggtgctg      2280
     cccccaatcg ccgaagccgt cgccgagtgg aggctgacgg cggcgacgac gacgtcgacg      2340
     attgacctcg gaaagtactg gcgcaggtac accatggacg atcacaacat ccagggccga      2400
     gcgatcgtcc ccggcgccgg ttggctggcg ctgatcgctc acgaggcggg gacgtccaag      2460
     ctcgcggatg tggcgtttat gcgcggcgtg ttcgagcccg acacgaccat cagggtggtg      2520
     aagaggcggc ggctgatgca ggcgacggcg ggcgaagaga cgatcctcaa ggcgagtctc      2580
     gtgtcgggag atgccgcgcc ggagacaatc ggcccggacg tgttcggccg cggggtcgcc      2640
     ctcgggtcgc cgtcgaagaa gaagcccgct cgcgggaaag aaaacggcgt cgaggagaac      2700
     agcgtcgccg acaacggagt cgaacaaagc gacgcttcca gaaacaaaaa cgccgaggcc      2760
     gtcggcgtca agatcaccga cgactccaac cacgagcagc actaccgccg gtgctccgcg      2820
     ctcaggctcg agtacggcgg cgcgtacagg gccatcgaga gggtggcttg gtccgggcac      2880
     gcgttccgcg cggagtgctt cccgcggacg cacctcgccg cggtgttgga cgccgggctt      2940
     caggttgtgt gcgcgtccgt tcgggccaac acgttcatcc ccgtcgcggt ggcagacttt      3000
     cagattacag agggcgtgga cgcctttgac gagtcgcgcc ggtgcgtagt tcacggggag      3060
     attctcgagc agtaccccga gtttctcgtc gcggatctca ggtacgagta cgaaggagtg      3120
     cagggttcga gcggagtgca gggttccaaa agcggcggag tgcagggttc gagcgggaag      3180
     aagaagaaga aggcgagcgt cgtctcttcc tcgtccgccg ccgccgcgac gactggaaac      3240
     ggggtgtttg cgtcgatggg ccgcgccagg ttcgcgcgcg tcgagggaac gaagccccgt      3300
     ttgcagccca ccaaggccaa ggaggctaac cccaccgcgt cgccgttcgg gtcgcagacg      3360
     ttggacccca agacggcgct cgccaggctc aggcagctca cgacggagca gcgggtggac      3420
     gcggttcgat ccgtgattgg ctcgatcgtc tccgatctga ccgacgccga cgtggacttt      3480
     tcaaagacgg tgtttgacaa cgggatgcac tcgctcaacg cggtggagct gctgtccagg      3540
     ttgaaccaga cgctgggcac gggggtcacc accaagctgg tcgtcaacga cgcgccgatg      3600
     gccgactttg ccgtcgccgt cgccgagcac gcgacgacgt tcgagtccac cgccgacgat      3660
     ccaaacgcca aaccgttccc caacgtggac tacgccaacc tcaacgagat cgtgcgccgg      3720
     aggctggcgg gtaagacggt cgggaacacc ccgtactggt tcctgttcaa gtacataacg      3780
     tacaactttt ggaagaaatc gttccagttt ttccgcatcg gcggtcacaa gttcctgatg      3840
     aacccgccga gggagattga cctctcgttg gaggtgagga tggaccgcgt ggtggagttc      3900
     cgggacgtgg atatgaacca gcactacacc gtggagatga tcgtggcgag gagcgtggac      3960
     ggcgtggagc agctcatggc caaatcgggc ttgacacaca tcgagcacta ctaccgacgc      4020
     aacctcttcg cggcgaagat ccagtccacg ttccacaagg agctcgcgca cggggacaga      4080
     tacgtcataa agacgaagat cacgaaggtg accgggtcgc tgatggacat ccgggtggcg      4140
     ttcctggacc ccgacgacgt gctgtgcttt gagattctgt ggaccatcct catcgtgttg      4200
     gactccaacg agcggctgct cctagactgg gagaacgtcg acctcatgga tagcgggagg      4260
     aggctcatcg cggggccggg caagggcagg gcggaggcgc ccacgtcggc gagcaaggga      4320
     ctcaaatcct catcaaaacc ctcatccgtc gcaggtgtcg agtcgggacg cacgattcac      4380
     accaagtaa                                                              4389
//

If you have problems or comments...

PBIL Back to PBIL home page