(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE213

MICSR_1.PE213        Location/Qualifiers
FT   CDS_pept        join(complement(430109..430266),complement(428644..429982))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636553"
FT                   /orf_name="MICPUN_105259"
FT                   /product="Predicted protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /function="protein dimerization activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62129.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AAC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E190"
FT                   /transl_table=1
FT                   /translation="MHSSSSGELETQRPVCRICWENTCEVNGSEEFLSPTPCSCRDERS
FT                   NVHQACLERWILEARSQGRFDAGTICHACGDHYSHPALSLTVLSDEAVRDAKISTASGG
FT                   GEGVDHREPLAIIGGTGYVGRSLALHLLGHPTFRLGAIVGSSATVGKPFSAVFEKKEEA
FT                   LAEHYGADLWKPMDFPTELMSARVCGVEDVIERGECRTALSFIAPEHGEIEDRLAAAGI
FT                   KVFSISPHARFDPSNPLSVPEANPEVLKDAVDKAAGEGFEGDCHSLVKSPNCVTCGVVV
FT                   ALKALDAAFGVEDVSVTTFQSLSGRGDAKYPRDVVMGNVYPLHGTVERTGEYQHGELKR
FT                   IMPDVKRVSVAAYRVPVQRGHLVDVRVRFRCETKPTARAVERALSSFDPLRDVPLPSKP
FT                   RRVIYVKPLDEEETGPRIGTPRPKDDHEYEGGMSVCVGNVVCEDELYDVRFCLVVNNVV
FT                   RGAWGAALLNAEYWHWLKGRKTAAPGEEPAAPSAAARIEC"
     atgcactcca gctccagcgg ggagctcgag acccaacgtc ccgtgtgtcg catctgctgg        60
     gagaacacgt gcgaggtgaa cggcagcgag gaatttctat cgcccacgcc ttgctcgtgc       120
     agggatgagc gctcgaacgt ccaccaggcg tgcctagagc gatggattct cgaggcgagg       180
     tcccagggta ggttcgacgc gggcacaatc tgccacgcgt gcggagatca ctactcgcac       240
     cccgcgctct ccctcaccgt cctctccgac gaagccgtgc gcgacgccaa gatctccacc       300
     gcctccggtg gcggagaggg cgtcgaccac agggagcccc tcgccatcat cggcggcacc       360
     gggtacgtgg gtagatcctt ggcgctccac ctcctcggcc accccacgtt caggctcggc       420
     gccatcgtcg gatcgtcggc caccgtcggc aaaccgttca gcgcggtgtt tgaaaaaaaa       480
     gaagaggctc tcgccgagca ctacggcgcc gacctgtgga agccgatgga tttccccacg       540
     gagctcatgt ccgccagggt gtgcggcgtg gaggacgtca tcgagcgcgg cgagtgccgc       600
     accgcgctct ccttcatcgc cccggagcac ggtgagattg aggacaggct cgcggcggcg       660
     ggcatcaagg tcttctccat ctctccccac gcccggttcg acccgtccaa tccgctctcc       720
     gtccccgagg ctaacccgga ggtgctcaag gacgcggtgg acaaggccgc cggcgagggg       780
     ttcgagggcg actgccacag cctggtcaag tctccgaact gcgtcacctg cggcgtggtg       840
     gtggcgctca aggcgctgga cgcggcgttt ggagtggagg atgtctcggt gacgacgttt       900
     cagtctctga gcggccgcgg cgacgccaag tacccgaggg acgtggtgat gggtaacgtg       960
     tacccgcttc acgggacggt ggagcgcacg ggagagtacc agcacggcga gctgaagagg      1020
     atcatgcccg acgtgaagag ggtgtccgtg gcggcgtacc gggtgccggt gcagagaggg      1080
     cacctcgtgg acgtgagggt tcggttcagg tgcgagacga agcccacggc gagggccgtg      1140
     gagcgcgcgt tgtcctcgtt cgacccctta cgggacgttc cgctgcccag caagcccaga      1200
     cgggtgatct acgtgaagcc gctggacgag gaggagacgg ggccgaggat cggtacgccc      1260
     cggcccaagg atgatcacga gtacgagggc gggatgagcg tctgcgtggg taacgtggtg      1320
     tgcgaggacg agctgtacga cgtgaggttc tgcctggtgg tgaacaacgt ggtgcgaggg      1380
     gcgtggggcg cggcgctgct caacgccgag tactggcact ggctcaaggg gaggaaaacc      1440
     gcggcgcccg gggaggaacc ggctgccccc tcagccgcgg ctcgcatcga gtgctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page