(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE216

MICSR_1.PE216        Location/Qualifiers
FT   CDS_pept        join(<434836..434949,435175..>435906)
FT                   /codon_start=1
FT                   /gene_family="HOG000200793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636556"
FT                   /orf_name="MICPUN_71524"
FT                   /product="Predicted protein"
FT                   /function="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase activity"
FT                   /biological_process="lipid A biosynthetic process "
FT                   /protein_id="ACO61698.1"
FT                   /db_xref="GO:0008759"
FT                   /db_xref="GO:0009245"
FT                   /db_xref="HOGENOM:HBG482342"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AAC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E193"
FT                   /transl_table=1
FT                   /translation="QQTVRRSFTLIGVGLHSGEWETVRVCPARAGEGRYFVRVRIPAAA
FT                   ALAQDNLRLSMRLAVDDDNGVITCEHLLSALEAIGVDNARIELEGSGEVPIVDGSAYQF
FT                   AYECARVGLVPAHADGSTAEVPRMAWRPSEMITVRDGDAFVQFIPDAVTKLTYGVDFTY
FT                   KSTAIGKQWESWTPTEDGDYVDLIARARTFGTMQDYMAYFRAGYIRGGLEQCALIANGD
FT                   KFWNPPMILPNENARHKILDLVGDLSLMAEPGMAGVPIGHVLAYKGSHRLHAKFLAALA
FT                   A"
     cagcagaccg ttcgccgcag cttcaccttg atcggcgtcg ggctccactc gggcgagtgg        60
     gagacggtgc gggtgtgccc cgcgcgcgcc ggcgagggca ggtacttcgt tcgcgtcagg       120
     atcccagccg cggcggcgct cgcgcaggac aacctccgcc tctccatgcg cttggcggtg       180
     gacgacgata acggcgtcat cacctgcgag cacctgctgt ccgcgctcga ggcgatcggc       240
     gtggacaacg cgaggatcga gctcgagggt tccggcgagg ttcccatcgt ggacgggtcc       300
     gcgtaccagt tcgcgtacga gtgcgcccgc gtcggcctcg tccccgcgca cgccgacgga       360
     tccaccgcgg aggtgccccg gatggcgtgg cgacccagcg agatgatcac cgtgcgagac       420
     ggcgacgctt tcgtgcagtt catcccggac gccgtcacca aactcaccta cggcgtcgat       480
     tttacgtaca agtcgaccgc cataggcaaa cagtgggaga gctggacgcc cacggaggac       540
     ggcgactacg tcgacctcat cgcgcgcgcg agaaccttcg ggacgatgca ggactacatg       600
     gcctacttcc gcgcgggata catccgcggc ggcttggagc agtgcgcgct catcgccaac       660
     ggcgacaagt tttggaaccc gccgatgatc ctccccaacg agaacgccag gcacaagatc       720
     ctcgatttgg tcggggacct ctcgctcatg gcggagcccg ggatggcggg cgtgcccatc       780
     ggtcacgtgc tcgcgtacaa gggctcgcac aggctccacg caaagttttt ggcggcgctg       840
     gcggcg                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page