(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE218

MICSR_1.PE218        Location/Qualifiers
FT   CDS_pept        join(437213..437412,437529..437638,437773..437831,
FT                   437995..439098)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636558"
FT                   /orf_name="MICPUN_99369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61699.1"
FT                   /db_xref="HOGENOM:HBG560067"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199AAC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E195"
FT                   /transl_table=1
FT                   /translation="MLLEKLPAHVLRDVFGFLSAGDVARAACACKTFKQVARSESLWRK
FT                   LLSEKLGSQASIVLPKTLPNERYPHGDMVVEPAWKEMFQFWMNPGPNSYSWMEHAKGEE
FT                   LENRGKFAARYLHRCTAIGDGNKILLFGGQGSGADFFNDLHLLDLRKKSLQLEQLDAAG
FT                   DPPFPRCSGTLTAVSVTGIPGSEVVALFGGSQGFFEGFSNSLCILQGDENVSISDAASQ
FT                   HKGLTWREPLVVAADPEDGVPDARWGHSAVSWNGKLVLFGGSNTQHCFNDTWVLDVGLN
FT                   PREPESRRLLATWKKLKLGNDARPPSRAGQTVSLVGDALYVFGGCHISDVFNDLWRLDL
FT                   GVRVPTWERLDVAGTPPAPRVGHAAVVLGDRIVFSGGRGSPTAGASGTYATADQGLATM
FT                   QGLTFFEGGFAMLDISRGTWMPIQHPNRNNHVYLRGEDDGAVDMEDAAMEDEVWEHRTG
FT                   HVMVPAKDGLLVIGGLAYNGEFQNDVQHIRVF"
     atgctcctcg agaagctacc ggcccacgtt ctccgagacg tgttcggttt tttgagtgcc        60
     ggcgacgtcg cgcgcgcggc ctgcgcgtgc aagaccttca agcaggtcgc tcgatccgaa       120
     tccctgtggc gcaagctcct ctccgaaaag ctgggcagcc aggcttcgat cgtcctgccc       180
     aagacgctgc cgaacgagcg gtaccctcac ggcgacatgg tcgtggaacc cgcttggaag       240
     gagatgttcc agttctggat gaaccccgga ccgaactcct actcgtggat ggagcacgcg       300
     aagggcgaag agctcgagaa taggggaaag ttcgcggcga ggtacctgca tcgctgcacc       360
     gccatcgggg acggcaacaa gatcctgctc ttcggcggcc agggcagcgg cgcggacttt       420
     ttcaacgatc tgcacctgct cgacctgagg aagaagtccc tgcagctcga gcagctcgac       480
     gccgccggcg acccgccctt cccgaggtgc tcgggcacgc tcaccgcggt ttccgtgacg       540
     ggcatcccgg gcagcgaggt cgtggcgctc ttcggcggct cgcaggggtt cttcgagggc       600
     ttctccaact ctctctgcat ccttcagggc gacgagaacg tcagcatcag cgacgcggcg       660
     agccagcaca agggtttgac gtggagggag ccgctggttg tcgcggctga tcccgaagac       720
     ggcgtgcccg acgccaggtg gggtcacagc gcggtgtcct ggaacggaaa gctcgtgctc       780
     ttcggcggca gcaacaccca gcactgcttt aacgacacct gggtcctcga cgtcggcctc       840
     aacccgcggg agcccgagtc cagaaggctt ctggcgacgt ggaagaagct caagctcggg       900
     aacgacgcgc gaccgccgtc gagggcgggc cagacggtga gcctggtcgg cgacgccctg       960
     tacgtgttcg gcgggtgcca catcagcgac gtgttcaacg acctgtggcg tctggacctc      1020
     ggcgtgcggg ttcccacctg ggagaggctc gacgtcgcgg ggacgccccc cgcaccccgg      1080
     gtgggtcacg ccgcggtggt gctcggcgat cgcatcgtct tctccggcgg ccgcggcagc      1140
     ccaaccgcgg gggcgagcgg aacctacgcg accgcggacc agggcctcgc caccatgcag      1200
     ggcctgacgt tcttcgaggg tggcttcgcg atgctggaca tctcgcgggg cacgtggatg      1260
     cccattcagc atcccaaccg caacaaccac gtgtacctgc ggggcgagga cgacggcgcc      1320
     gtcgacatgg aggacgccgc catggaggat gaggtctggg agcaccgcac gggccacgtg      1380
     atggtgccgg cgaaggacgg tttactcgtc atcgggggtt tggcgtacaa cggggagttt      1440
     cagaacgatg tccagcacat cagggtgttc tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page