(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE219

MICSR_1.PE219        Location/Qualifiers
FT   CDS_pept        join(complement(440268..440663),complement(439986..440123),
FT                   complement(439299..439901))
FT                   /codon_start=1
FT                   /gene_family="HOG000265463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636559"
FT                   /orf_name="MICPUN_80065"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62132.1"
FT                   /db_xref="HOGENOM:HBG635246"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="UniParc:UPI000199AAC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E196"
FT                   /transl_table=1
FT                   /translation="MQECLTHPEFGYYMHRDVFGEAGDFVTSPEVSQAFGELMGAWAAW
FT                   TWESMGKPSTVRIVELGPGRGTLMADLLRGTKNLKGFADAVTVHMVDVSPANRKAQREA
FT                   LKCGPKTDDAENGDDNTGKNPTRHGLGKWHETMDAVPPGPTIVIAHEFFDAMPVHQFTR
FT                   TERGWCERLVAISGDMVLSPGLTPAGALMVPRRLEGVEASRRDGLRQLEISPRSLAIWE
FT                   RIAARLEEHGGAAIAIDYGEEGPLGDTLQAIRDHEFVDVLTDPGRADLSAYVDFGAMRR
FT                   VIETRKNSGVECHGPVTQRDLLFGLGIGQWLEKMVEKCATEKEVDKLIAGCERLVSGEQ
FT                   GALGEGGRTEGAGKGAGMGFRYKALAMVSKGLGKPAGF"
     atgcaggagt gcctgacgca cccggagttt ggctactaca tgcaccgcga cgtcttcggc        60
     gaggcgggcg actttgtcac ctcgcccgag gtgtcgcagg cgttcgggga gctcatgggc       120
     gcgtgggcgg cgtggacgtg ggagagcatg ggaaagccgt ccaccgtgcg gatcgtggag       180
     ctcgggcccg ggcggggcac attgatggcg gatctgctca gggggaccaa gaacttgaag       240
     ggtttcgccg acgccgtcac cgtgcacatg gtggacgtgt cgccggccaa cagaaaggcg       300
     cagagggagg cgctcaagtg cggcccgaag acggacgacg cggagaacgg ggatgacaac       360
     acagggaaga acccgacgag gcacgggctg ggaaagtggc acgagaccat ggacgcggta       420
     ccgcccgggc ccacgatcgt catcgcgcac gagttcttcg acgctatgcc ggttcaccag       480
     ttcacccgca cggagagggg ttggtgcgag aggctcgtgg ccatctccgg cgacatggtg       540
     ctgtcgccgg ggctcacccc cgcgggtgcg ctcatggtgc cgcgcaggct cgagggcgtg       600
     gaggcgtcgc ggcgcgacgg gctgaggcag ctggaaatat cgccgaggtc gctcgccatt       660
     tgggagagga tagccgctcg gctggaggaa cacggcggcg cggctatcgc catcgattac       720
     ggcgaggagg ggccgttggg cgataccctg caggcgataa gggatcacga gttcgtcgac       780
     gtgctgacgg atcccggacg cgcggacctc tcggcgtacg ttgactttgg ggcgatgcgg       840
     cgggtgattg agacgaggaa aaactcgggc gtcgagtgcc acgggccggt gactcagcgg       900
     gacctgctct tcggtctggg catcgggcag tggctcgaga agatggtgga aaagtgcgca       960
     acggagaagg aggtggataa gctcatagcg gggtgcgaga ggctggtcag cggcgagcag      1020
     ggtgccctgg gtgagggcgg gaggacggag ggagcaggga agggagccgg gatggggttc      1080
     aggtacaagg cgctggccat ggtcagcaag ggcctgggca agcccgcggg attctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page