(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE22

MICSR_1.PE22         Location/Qualifiers
FT   CDS_pept        39478..40530
FT                   /codon_start=1
FT                   /gene_family="HOG000079206" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636027"
FT                   /orf_name="MICPUN_79568"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61595.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AAB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P9"
FT                   /transl_table=1
FT                   /translation="MNGGNSELPTVSLASFIGECGGCVVGDEPTPEQRLTAGQIDAVFR
FT                   RHGFLYLTDFGVSEEDVRVVFNNMKRLFALNDEEKAKLSKFDPRTNTGFSKFATEALNT
FT                   LRPPDLKESFNIRSRKHYTNDYTGTPEGFGDVAESFWDKLEEASRRLFIACALAMKLPR
FT                   EDMRFFERTFRRFDFSTLRMLHFPPVEDFSPDKLTRDGDALRIGEHTDFGMVTLLFHDA
FT                   ESAGEGLQVKKADAGAGNDASGVAGTNTGWIDAISRGGATAIVNTGALIARWTNDEWRA
FT                   TAHRVVVPNDAAAGRDRYSLAFFLDPDKDEVIETHPRFSDAVDKYKPITSGGFVQMKIE
FT                   EMLKVQGKAT"
     atgaacggcg gaaactcgga acttcctacg gtgagtctcg catctttcat cggagaatgc        60
     ggcgggtgcg tcgtgggtga cgaacccacc cccgagcagc gcctcaccgc cgggcaaatc       120
     gacgcagtct tcagacgcca cggctttctt tacctgacgg actttggcgt ctccgaggag       180
     gatgtcaggg tcgttttcaa caacatgaag cgtctcttcg cgctcaatga cgaggagaag       240
     gccaagttga gcaagttcga cccgaggacg aacacgggtt tcagcaagtt tgccaccgag       300
     gctctgaaca ccctcaggcc ccctgacctt aaggagagct tcaacatccg gtcgaggaag       360
     cactacacaa acgattacac aggcactccc gagggctttg gagacgtcgc cgagtcattc       420
     tgggataagt tggaggaggc atccaggagg ctgttcatag cgtgcgcgct cgccatgaag       480
     ctgccgaggg aggacatgag gttcttcgag cgaacgttcc gacgcttcga cttctccacg       540
     ctgcggatgc ttcacttccc accggtggag gatttctccc cggacaagct cacgagggat       600
     ggcgacgcgc tgaggatcgg cgagcacacc gactttggga tggtcacgct gctcttccac       660
     gacgccgaga gcgcgggcga ggggctgcag gtgaaaaaag ccgatgccgg ggctgggaac       720
     gatgcgagcg gcgtggccgg cacaaacacc ggctggatcg atgccatcag ccgtggcggc       780
     gcgacggcca tcgtgaacac cggcgctctc atcgcgaggt ggacgaacga cgagtggagg       840
     gccacggctc acagggtggt ggttcccaac gatgcggccg cgggaaggga taggtattca       900
     ctcgccttct ttctggatcc cgacaaggac gaggtcatcg agacgcaccc gcggttcagc       960
     gacgccgttg acaagtacaa gccgataacc agcggcgggt tcgtccagat gaagatcgag      1020
     gaaatgttga aggtgcaggg aaaggcgacc taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page