(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE220

MICSR_1.PE220        Location/Qualifiers
FT   CDS_pept        join(442341..442805,442950..443651,443853..445088)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636560"
FT                   /orf_name="MICPUN_79939"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61700.1"
FT                   /db_xref="HOGENOM:HBG560068"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199AAC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E197"
FT                   /transl_table=1
FT                   /translation="MSTARPHLQLYETLVDCGRLHNALELLRALKTAGLNTVGGRVSNK
FT                   AFLRQCARRSAVAVAFDFVSFVDYPDVRLYNMLLSVCASAADSRSAFAAFVMMYDNGVQ
FT                   PDVMAYTTLISACAKAGELEKAFETFRRMEMDGLEGNVVTYGALMDALSRRVAATLRRC
FT                   FDLREEMDDAGVAPDGTMINTILSACGRAAEVRALSADALQKAFDLYDEMESSDEADLA
FT                   PDAYTYSALIKACVNAGQSMRGLSLYDRAMDPSAGIEPSIMVFQEAMIACSHLADLGKA
FT                   WAIWEDMRVERVAPDAMLYATLIAVAGRAGKREEAERVVFEMERAGVAPTPEVFASLAG
FT                   IAARAGDGAGVESAIAEVASRGLAVPLEMYNALVTAAARRGDVDAAQEAMFEAEAEMRA
FT                   AGLEPDEQTWCELLSSCARHGDASLTWDTYKRSRKAGQPPSEVALNILIGVTLLKIRAL
FT                   TDPDDRRNIKRMSQWDQDDDSAGRKKEEPEWTEWADRAIAAYHEATVAGVRPRLATFSA
FT                   MLACLRPPTLPSLRAVDRETRPGSKAESLARAVSHEDSSHEDARKYYPLRALIMYEEAQ
FT                   AIGVVPKFATETDSVYDIRKFPPAAAEVAVLTMLRVFRRRSDAHAGAGDDELPNVTLRV
FT                   LSDEEHEEMIASGDDEGRRLAQTGDRVIVLLRRLRFNYGGSLSAGRIELSGHVIKRWLQ
FT                   AKPPKDERAPGVEAGLRQNLQDQARNIRMQSFDDSDGSGYGGGATDWGAIFGRRGGGAG
FT                   GRLGVGRRPLLPRRRLVKGEKRTEDREERGVAREITSVPLARASHLL"
     atgtccaccg cgcggccgca cctgcagctc tacgagactt tggtggactg cggcagactc        60
     cacaacgcgc tcgagcttct gcgggcgctc aaaaccgcgg gcttaaacac cgtgggcggc       120
     agggtgagca acaaggcgtt cctcaggcag tgcgccaggc ggagcgcggt tgccgtggct       180
     tttgatttcg tgtcgttcgt ggactacccc gacgtgcgac tctacaacat gctgctgtcg       240
     gtgtgcgcct ccgccgcgga ctccaggagc gcgttcgccg ctttcgtcat gatgtacgac       300
     aacggggtcc aaccggacgt gatggcgtac acgacgctca tcagcgcgtg cgccaaggct       360
     ggggagctgg agaaggcgtt tgagacgttt cggcggatgg agatggacgg gctggagggt       420
     aacgtcgtga cgtacggcgc gctcatggac gcgctgtccc ggcgcgttgc cgcgacgctc       480
     cggcgatgct tcgaccttcg cgaggagatg gacgacgcgg gggtcgcgcc cgacggtacc       540
     atgataaaca ccatcctcag cgcctgcggc agggcggcgg aggtccgcgc gctgagcgcc       600
     gacgccctcc aaaaggcgtt cgacctctac gacgagatgg agtcgtcgga tgaagccgac       660
     ttggcgcccg acgcgtacac ttactcggcg ctgatcaagg cgtgcgtcaa cgcgggtcaa       720
     tcgatgaggg ggctctcgct gtacgaccgc gcgatggacc cgagcgcggg catcgagccc       780
     tcgatcatgg tgttccagga ggcgatgatt gcttgctcgc acctcgccga tctcggcaag       840
     gcttgggcga tttgggagga tatgcgggtc gagcgagtgg cgccggatgc gatgctctac       900
     gcgaccctca tcgcggtcgc cggcagggcc gggaagcgcg aggaggcgga gcgcgtcgtc       960
     ttcgagatgg agcgcgcggg ggtcgcgccc acccccgagg tgttcgcgtc gctcgccggc      1020
     atcgccgcga gagccgggga cggagccggc gtcgagagcg ccatcgcgga ggtggccagc      1080
     cgcggcttgg cggttccgct ggagatgtac aacgccctcg tgacggccgc ggcgaggcgc      1140
     ggggacgtgg acgccgcgca ggaggctatg ttcgaggcgg aggcggagat gcgcgcggcg      1200
     ggcttggagc ccgacgagca gacgtggtgc gagctgctga gctcgtgcgc tcggcacggc      1260
     gacgcgtcgc taacctggga cacgtacaag cgcagccgca aggctggcca gcccccgtcc      1320
     gaggttgcgc tcaacatcct catcggcgtc accttgctca agatccgcgc cctcaccgac      1380
     ccggacgacc gcaggaacat caagcgaatg agccagtggg accaggacga cgactccgcc      1440
     ggacggaaaa aggaggagcc cgagtggacc gagtgggccg atcgagccat cgccgcgtac      1500
     cacgaagcca ccgtcgcggg ggtcaggccc aggctcgcca ccttctccgc tatgctcgcg      1560
     tgcctccgcc cgcccacgct gccgtccctg cgcgccgtgg acagggagac gaggccgggg      1620
     tccaaggctg agtcgctcgc cagagccgtc tcacacgagg actcgtcgca cgaggatgcg      1680
     cgaaagtatt atccccttcg cgcgctcatc atgtacgagg aggcgcaggc gatcggcgtc      1740
     gtcccaaagt tcgccactga gacggacagc gtgtacgaca tcaggaagtt tccacccgcg      1800
     gcggcggagg ttgccgtgct caccatgctt cgcgtcttta ggcggcgctc agacgcgcac      1860
     gcgggtgcgg gcgacgacga gctgcccaac gtgacgctga gggtgctgtc ggatgaggaa      1920
     cacgaggaga tgatcgcgtc cggggacgac gagggcaggc gtttggcgca gacgggcgac      1980
     cgcgtcatcg tcctgctccg ccgtctgcgg ttcaactacg gcggatctct gagcgccggg      2040
     cgaatcgagc tctccgggca cgtcatcaag cgttggctgc aggcgaagcc gcccaaggat      2100
     gagcgcgccc ccggcgtgga ggcgggtttg cgccagaacc tccaggacca ggccaggaac      2160
     atccgcatgc agtccttcga cgattccgac gggtccgggt acggcggcgg cgccaccgac      2220
     tggggcgcca tcttcgggcg gcggggcggc ggggcgggcg ggcgactcgg ggtcgggcga      2280
     cgtccgctac tcccgagacg gcgactggtg aagggagaaa agaggacaga ggacagagaa      2340
     gaaaggggcg tcgcacgcga gatcacctcc gtccccttag cgcgagcctc tcatttgttg      2400
     tga                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page