(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE221

MICSR_1.PE221        Location/Qualifiers
FT   CDS_pept        complement(445152..446276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636561"
FT                   /orf_name="MICPUN_56794"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62133.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199AACA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E198"
FT                   /transl_table=1
FT                   /translation="MGGTDGSPGSTTGRHHRDEEERSWLEMLAADDDVEGPSLLRAPDV
FT                   LTRNGASPDAPVLDDDGLLLRPLGSLGDDDDDFACGGDVCDLVHRAPVHGGIARGVISA
FT                   LRRSATDVGGELGRRRADVRAAASPRGVAPRGEARRRPPDRGGGGHTRGQHSPLAGGPG
FT                   DASLVERLRDSLCPDRAEDLSERRGARGGLRRARTLPTNLHAHDDDLPLDPRAAQADVV
FT                   AARAVEAAAQAASPRPFGYLGVTRPPWTTRWEANLVDEHTGGHVFLGNFDQKESAARAH
FT                   DAAKLKLALGDDEPVPQDQLNFDASDYREELSAMTECTFEDFVKTLVTHSYGGSRSAGH
FT                   SKFRGVFAREDGLWEAKLDAEDAGGAREDRRWKK"
     atgggcggga cggacggaag ccccgggagc acgacgggcc gccaccatcg cgacgaggag        60
     gagcgctcgt ggctcgagat gctcgccgcg gacgacgacg tcgagggccc ctcgctcctt       120
     cgcgcgcccg acgtcctgac gaggaacggc gcgtcaccgg acgcgccggt cctcgacgac       180
     gacggcctgc tcctccgccc gttgggttcg ctcggcgacg acgacgacga cttcgcctgc       240
     ggcggcgacg tttgcgacct cgtccatcgt gccccggtcc acggcgggat cgcgcgcggg       300
     gtcatctccg cgctccgccg ctccgccacg gacgtcgggg gcgagctcgg gcgtcgccgc       360
     gcggacgttc gtgccgccgc gagcccccga ggtgtcgcgc cgcgcggcga ggcccgccgg       420
     cgcccccccg atcgcggcgg gggcgggcac acgcggggcc agcactcccc gctcgcgggc       480
     ggaccgggcg acgccagtct cgtggagagg ctgcgcgaca gcctgtgccc cgaccgcgcg       540
     gaagacctct ccgagcggcg cggcgcgagg ggcggcctca ggcgcgcgcg aacgctcccg       600
     acgaacctgc acgcgcacga cgacgacctc ccgttagatc cgcgcgccgc gcaggcggac       660
     gtcgtcgccg cgcgggccgt cgaggccgcc gcgcaggccg cgagcccccg accctttggc       720
     tacctcggcg tcacgcgccc gccgtggacc acgcggtggg aggctaacct cgtggacgaa       780
     cacacgggcg ggcacgtgtt cctcggcaac ttcgaccaga aggaatccgc cgctcgggcc       840
     cacgacgccg ccaagctcaa gctcgccctc ggggacgacg agcccgtgcc ccaggaccag       900
     ctcaacttcg acgcgagcga ctaccgcgag gagctctccg ccatgacgga gtgcacgttt       960
     gaggatttcg tcaagacgct cgtgacgcac tcgtacgggg ggagtcgaag cgcggggcac      1020
     tcaaagttcc gcggcgtctt cgcgcgggag gacggcctgt gggaggcgaa gctcgacgcc      1080
     gaggatgccg gcggggcgcg cgaggaccgg cggtggaaga agtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page