(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE222

MICSR_1.PE222        Location/Qualifiers
FT   CDS_pept        join(complement(447390..448301),c
FT                   omplement(<447183..447359))
FT                   /codon_start=1
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636562"
FT                   /orf_name="MICPUN_79518"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62134.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="UniParc:UPI000199AB35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E199"
FT                   /transl_table=1
FT                   /translation="MKFDVEVFRYIEKDAWRVLVSVEMGMKNHELVPVELINAISGLKH
FT                   GGAFKFIRDLLKHKLVHHDNSKYDAYRLTPLGYDYLAIKAFVNRGAIEGVGRRIGVGKE
FT                   SDVYEVVTEDGETLALKLHRLGRTSFRAVKSKRDYIKKTTTHTNWLYLSRLAALKEHAF
FT                   MKALGDNGFPVPVAVDVNRHAVLMSIVDGYPLTQVGPSRLETGAVGRVYKQCVDQLENL
FT                   ARHGLVHCDFNEFNIMVNPETTNITVIDFPQMVSTKHPNAEELFVRDLKCLHKFFLRRF
FT                   DYRASEDPDGRRDPVFFEIAGGGKSLDVSLRASGFTQKQSKELEEYQAAKEAEENGGGG
FT                   GGDDDDEDDDDEDDDSELDDDDD"
     atgaagttcg acgtcgaggt gttccgctac atcgagaagg acgcctggcg cgtcctcgtc        60
     tccgtggaga tgggcatgaa gaaccacgag ctcgtcccgg tggagctcat caacgccatc       120
     tcgggcctga agcacggagg cgcgttcaag ttcatccgag acttgctcaa gcacaagctc       180
     gtgcatcacg acaacagcaa gtacgacgcc taccgtctca ccccgctcgg gtacgactac       240
     ctcgccatca aggcgttcgt caaccgcggc gccatcgagg gcgtcgggcg gcgcatcggc       300
     gtcgggaagg agtccgacgt ctacgaagtc gtcaccgagg atggggagac gctcgcgctg       360
     aagctccaca gactcggtcg aacctcgttc cgcgccgtca agagcaagcg cgattacatc       420
     aagaagacga ccacccacac caactggctc tacctctcga ggctcgccgc gctaaaggag       480
     cacgccttca tgaaggcgct cggcgataac ggttttcccg tgcccgtcgc cgtcgacgtc       540
     aacaggcacg ctgtgctcat gtccatcgtc gacgggtacc ccctgacgca ggtgggaccg       600
     tccaggctcg agacgggggc ggtggggcgg gtgtacaagc agtgcgtgga tcagctggag       660
     aacctcgcgc ggcacgggct cgtgcactgc gactttaacg agtttaacat aatggtcaac       720
     ccggagacga cgaacatcac ggtgattgac tttccgcaga tggtgagcac caagcacccg       780
     aacgcggagg aactgttcgt cagggacctg aagtgcctgc acaagttctt cctcaggagg       840
     tttgactaca gggcgagcga ggaccccgac ggtcggcggg atccggtgtt cttcgagatc       900
     gccggcgggg gcaaatcact cgacgtctcc ctgagagcca gcggtttcac gcagaagcag       960
     tcgaaggaac tcgaggagta tcaggccgct aaggaggccg aggagaacgg cggcggcggc      1020
     ggcggcgacg acgacgacga agacgacgac gacgaggacg atgattcgga gctcgacgac      1080
     gacgacgac                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page