(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE225

MICSR_1.PE225        Location/Qualifiers
FT   CDS_pept        452045..>452964
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636565"
FT                   /orf_name="MICPUN_56798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61702.1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniParc:UPI000199AB38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A2"
FT                   /transl_table=1
FT                   /translation="MWRRLLRGAEVWEDRQRTVLVTEASPGRWIRPVHEEDDLANPCVD
FT                   PCVECELLEDRCVGWVHVRDLQLSAPEPETHALRASRRYRGHRGLLHVPSVVAFVEAHV
FT                   ARTREDRARYKRGGTTGPSLFDASGFVQAAFANASSPRPVFIPRRVHEQHHFAEPVDDL
FT                   NEATPGDLVFFGVQPPNAFKGCVDVRHVGIITAVRCISGSSASCVELAFASVTDPIAGR
FT                   GIVARDSVIVPSRSSTPGARGGNWSTTWEFGRARPGPEHEGDAASERLAQTVLSVGRCR
FT                   RGVEGADDLPRGRTASSARCGGSSR"
     atgtggcgcc ggctcctgcg gggcgcggag gtgtgggagg accgtcagcg cacggtcctc        60
     gtcacggagg cgtccccggg tcgatggatc cgcccagttc acgaggaaga cgacctcgcg       120
     aatccgtgcg tcgatccgtg cgtcgagtgt gagctcctcg aggacaggtg cgtcgggtgg       180
     gtccacgtcc gggatcttca gctgtcggca cccgagccgg agacgcacgc gttacgcgcc       240
     agtcgcagat accgcggcca ccgcgggctg ctgcacgtcc cgagcgtcgt cgccttcgtc       300
     gaggcgcacg tcgcgcgaac ccgcgaggac cgcgcgcggt acaagcgggg cggcacgacg       360
     gggccgtccc tcttcgacgc atccggtttc gttcaggcgg cgttcgccaa cgcgtcatca       420
     ccccggcccg tgttcatacc gcggcgagtg cacgagcagc accacttcgc cgagcccgtg       480
     gacgacctga acgaggccac tcccggcgac ctcgtcttct tcggcgtcca acccccgaac       540
     gccttcaagg gatgcgtcga cgtgcgccac gtcgggatca tcacagctgt gcgatgcatt       600
     tcgggatcat cggcatcatg cgtcgagctc gccttcgcgt ccgtcaccga cccgatcgcc       660
     ggtcgcggga tcgtcgcccg cgacagcgtc atcgtgccct ctcggtcatc cacgccgggt       720
     gcccgcggtg ggaactggtc aaccacgtgg gagtttggac gcgcgaggcc cggcccggaa       780
     cacgagggcg acgcggcgtc ggagcgattg gcgcaaacag tactgagcgt cggtcgatgc       840
     agacggggcg tcgagggcgc ggatgacctg cctcgcggtc gcacggcgtc ctcggcacga       900
     tgcggggggt cgagcaggtg                                                   920
//

If you have problems or comments...

PBIL Back to PBIL home page