(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE226

MICSR_1.PE226        Location/Qualifiers
FT   CDS_pept        complement(453141..454427)
FT                   /codon_start=1
FT                   /gene_family="HOG000074814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636566"
FT                   /orf_name="MICPUN_79467"
FT                   /product="Predicted protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62136.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI000199AB39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A3"
FT                   /transl_table=1
FT                   /translation="MNRGWTAERAPPFTSRAPTLLARASADWDGETLGVLRRRANALET
FT                   RVKDALDVVDVERLAATVADLDAAASEGTLWDDPIKAKAVMAELADAKEQLATARGFEN
FT                   LLGDAAVALEMIDAEREDDSLSGAAANDASAGPDPTILAELSDACDNLERQLDKWEVRR
FT                   LLGGKYDAMPALVNVYAGAGGTDAQDWAEMLERMYRGWCNSRGFTWRTVERSEGEEAGL
FT                   KSVTFEVQGRFAYGYLRSERGTHRLVRQSPFKKDATRQTSFAAVEVTPVLDEGSVEELT
FT                   LRDSDLEISTMRSGGAGGQNVNKVETAVRIKHVPTGITVRCEEERSQAANKAKGLARLK
FT                   AKLVAVAEEQRAADVAAIRGDAVRAEWGQQIRNYVFHPYKMVKDVRTGKETSDVDGVMS
FT                   GDLDEFMDEFLRWKRKTEAEEEAALAANT"
     atgaaccgcg gatggaccgc ggagcgcgcc ccgcccttca cgtctcgcgc cccgactctc        60
     ctcgcgcggg catccgccga ttgggacggc gagaccctcg gggtcctccg ccggcgcgcg       120
     aacgcgctgg agacgcgcgt caaagacgcg ctcgacgtcg tggacgtcga gcgcctcgcc       180
     gcgaccgtcg ccgacttgga cgcggccgcc tccgaaggca ccctctggga cgacccgatc       240
     aaggccaagg cggtcatggc agagctcgcg gacgccaagg agcagctcgc cacggcgcgg       300
     gggttcgaga acctcctcgg agacgccgcc gtggcgctcg agatgatcga cgcggagaga       360
     gaggacgact ctctctccgg cgccgcggcg aacgacgcgt cggccggccc cgacccgacc       420
     atcctcgccg aactctcgga cgcgtgcgac aacttggagc gccagctgga caagtgggag       480
     gtgcggcggc tgctgggggg taagtacgac gcgatgccgg cgctggtgaa cgtctacgcg       540
     ggcgcggggg gcaccgacgc gcaggactgg gccgagatgc tggagcggat gtaccgcggc       600
     tggtgtaact cgagagggtt cacgtggcgc acggtggagc gcagcgaggg ggaggaggcg       660
     gggttgaaga gcgtgacgtt cgaggtccaa ggcaggttcg cgtacgggta cctgcgatcg       720
     gagcggggca cgcacaggct ggtgaggcag agtccgttta agaaggacgc gacgcggcag       780
     acgtctttcg cggctgtgga ggtgacgccc gtgttggacg agggttcggt ggaggagtta       840
     accctacggg attcggacct ggagattagc accatgcgga gcgggggcgc gggcgggcag       900
     aacgtgaaca aggtggagac tgcggtgcgg atcaagcacg tgccgacggg gatcacggtt       960
     cgatgcgagg aggagcgcag ccaggcggcg aacaaggcga agggcctcgc gaggctcaag      1020
     gcgaagctgg tggcggtggc ggaggagcag cgggcggcgg acgtggcggc gatcaggggc      1080
     gacgcggtgc gggccgagtg gggtcaacag attcgcaact acgtctttca cccctacaag      1140
     atggtgaagg atgtgagaac gggaaaggag acgagcgacg tcgacggcgt gatgagcgga      1200
     gacctggacg agttcatgga cgagttcctg cgatggaagc gcaagacgga ggccgaggag      1260
     gaagccgcgc ttgccgcgaa cacctaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page