(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE227

MICSR_1.PE227        Location/Qualifiers
FT   CDS_pept        454797..457436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636567"
FT                   /orf_name="MICPUN_99376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61703.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A4"
FT                   /transl_table=1
FT                   /translation="MDGAYESARARLKAQSKREPGADPGATRFGATRSRSLLSGGTKPK
FT                   ASSDGRERATTVEVVQGADDNIVDAQGRMTRALLHDATGCRDLSSATVADLHNADLTAL
FT                   ASGDLDACPNLVSLDLSFNQLVDIDGDALAPLTNLRALIVYNNRVASVKAVARVGQSLQ
FT                   TLQCQNNAITSLDGVEHLRRLAVLNASGNPLGDCKLIGRCTTLTRLDISRCGLEKLEGF
FT                   ATLHALEELNVSGNALTEISAVAKCAKLQELDVSHNALPPSALRDLKALKRLDVLNLEG
FT                   NALDHLNSMPRMEELTELNCAKNPLRTLPDDFPAKCPELQILDLGECQLAGDVASVVKA
FT                   LCGLDTLTELRLKFNPCAGGGSGGGHRPGRTHRRSSAAATAGRSTAPAASRPPARSAPT
FT                   AAGRRIRTAGPGTTGATMSARPPAPPPRAPARPPPPPQPDVSGDVWTPAADPWRGLDRA
FT                   AAAAATLGYRREVIRALPRCLYLDDVAVGDAERGGEEGGAGPRTRPDVPDVTDVTAGDD
FT                   GDERDENDVDALLKRRPQSARRPKAADMSAKAATADGHYEDVAVKFIKEMEDYKTKMSG
FT                   LIGKIRDGLKETRQEAVAALRSDGTLEAESDAVPSGRLPSAPIVGSVPTKKVGVLNKVD
FT                   EDKVGREAEAADSALRRGAEPPAAAVVQASPSPGKRPASARAKLVEAQDATRAVLEQFD
FT                   RLFSDKLFLDDVDGVGSPEGDEGITRTPEDRRRWIVRPPSARGGRPRSARGAGGIAEKV
FT                   AAAVAAVDAQLAAEVRDQKRAASEEEGTRATALAGTSKARPRSGGGNGGAGLGDDKDGR
FT                   RLRPPSLAGGSTGTLGKVLERTRTSSAAVAASRRPPSSGRLSTSGAAGGRGVPRATFRK
FT                   PPASGERR"
     atggacggcg cgtacgagag cgccagggcg aggctcaagg cgcagtcgaa gcgcgagccg        60
     ggcgcggatc cgggcgcgac tcgttttgga gcgactcgtt cgcgatctct tctctccggg       120
     gggacgaaac cgaaggcgtc gtcggacggc cgggaaaggg caacgacggt cgaggtcgtc       180
     cagggtgcgg acgataatat cgtggacgcg caagggcgga tgacgcgcgc gctactccat       240
     gacgccacgg gatgtcgcga cctgtcctcg gcgaccgtcg ctgacctgca caacgcggac       300
     ctcaccgcgc tcgcgtcggg cgatctcgac gcgtgcccga acctggtgtc gctggacctc       360
     agcttcaacc agctcgtgga catcgacgga gacgcgctcg cgccgctgac caatctacgc       420
     gcactcatcg tgtacaacaa tcgcgtcgcg tccgtgaaag ccgtcgcgcg ggtcgggcaa       480
     tcgctacaga cgctccagtg tcagaacaac gccatcacgt ccctggacgg cgtcgaacat       540
     ctccgaaggc tcgccgtcct caacgccagc ggcaacccgc tcggggactg caagttgatc       600
     ggacgatgca cgacgctgac gaggttggac atatcccgat gcgggctcga gaagctggag       660
     gggttcgcga cgcttcacgc gctcgaggag ctcaacgtca gcggcaacgc gctgacggaa       720
     atatccgccg tcgccaagtg cgccaagctg caagagctcg acgtatcgca caacgccttg       780
     ccgccgtccg cgctgaggga cctgaaggcg ttgaaacggc tggacgtgtt gaacctcgag       840
     ggcaacgccc tggaccacct gaactccatg ccgaggatgg aggaactcac ggaactcaac       900
     tgcgctaaga acccgctgcg gacgctgccc gacgactttc ccgccaagtg ccccgagctt       960
     cagatactcg acctcggcga gtgccagctg gccggggacg tcgccagcgt ggtgaaggcg      1020
     ctgtgtggac tggacacgct gacggagctc aggctcaagt tcaacccctg cgcggggggg      1080
     ggctcgggag gggggcatcg accggggcgg acgcaccgtc gctcgtcggc ggcggcgacc      1140
     gcggggagat cgacggcgcc ggcggcgtcc aggccgccgg cgcggtcggc tccaaccgcc      1200
     gccggccggc gcatcaggac cgccgggccg gggacgacgg gcgcgacgat gagcgctcgt      1260
     cccccggctc cgccgccgag ggcgccggct cgaccgccgc ctccacccca accggacgtt      1320
     tccggcgacg tctggacccc cgcggcggac ccgtggcgcg ggctcgaccg cgccgccgcg      1380
     gccgccgcga cgctgggata ccgccgcgag gtgatccgcg cgctgccgcg gtgcctctac      1440
     ctggacgacg tcgccgtcgg tgacgccgag aggggcggcg aagaaggggg agccggcccg      1500
     cggactcggc cggacgtacc ggatgtaacg gacgtaacgg ccggagacga cggggacgaa      1560
     cgggacgaga acgacgttga cgctcttctc aagaggcggc ctcagtccgc gcgccgtccc      1620
     aaggcggcgg acatgtccgc aaaggcggcg acggcggacg ggcactacga agacgtcgcg      1680
     gtgaaattta tcaaggagat ggaggattat aagaccaaga tgagcggttt gattggcaag      1740
     atacgggacg gcctgaagga gaccaggcag gaggctgtcg ccgcgttgag aagcgacggg      1800
     acgctcgagg ccgagtcgga cgcggtgccg tcgggcaggc tgcccagcgc cccgatcgtc      1860
     ggaagcgtac cgacgaaaaa ggtgggcgtc ctcaacaagg tcgacgagga caaggttggt      1920
     cgggaagccg aggctgccga cagcgcgctt cgacgcggcg ccgaaccgcc cgccgccgct      1980
     gtcgttcaag cgtcgccgtc gccggggaaa cgtccggcgt cggcgcgggc gaagctggtg      2040
     gaggcgcagg acgccacgag agccgtgctg gaacagttcg atagactgtt ctccgacaag      2100
     ttgttcttgg acgacgtcga cggcgtcggt tcaccggagg gggacgaagg gatcacgcga      2160
     acgcccgagg atcgccgccg atggatcgtg aggccgccgt ccgcgcgggg cgggcggccg      2220
     cgctcggctc gcggcgcggg tggaattgcc gaaaaggtcg ccgccgccgt cgccgccgtg      2280
     gacgcgcaac tagcggcgga ggtacgcgat caaaagcgcg ccgcgtcgga ggaggagggg      2340
     acgcgcgcga cggcgctggc cgggacgagt aaggcgcggc cgagatcggg cggcgggaac      2400
     ggcggggcgg ggctggggga tgataaagat gggcggcggc tcagaccccc gagtttggcg      2460
     ggtggctcga cggggacgct cggcaaggtt ctggagagga cgaggacgtc gtccgcggcg      2520
     gtcgccgcgt cgaggcgtcc gccgtcgtcg ggaaggctgt cgacatcggg agccgctgga      2580
     gggcgcggag tccctcgcgc gacgttcagg aagcctccgg cgtcgggaga gcggagatga      2640
//

If you have problems or comments...

PBIL Back to PBIL home page