(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE229

MICSR_1.PE229        Location/Qualifiers
FT   CDS_pept        459532..459873
FT                   /codon_start=1
FT                   /gene_family="HOG000183826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636569"
FT                   /orf_name="MICPUN_80228"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61704.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A6"
FT                   /transl_table=1
FT                   /translation="MDDDRGGRFESIPENDSGAPGPAKSVEGWIVLVTGVHEEAQEDDL
FT                   HEHFADYGEIRNMHLNLDRRTGFVKGYALIEYETKKEAQAAIDGANGSSMLDQTLEVSF
FT                   AFSKGPINK"
     atggacgacg atcgcggcgg caggttcgag tccatcccgg agaacgactc gggcgccccc        60
     ggccccgcca agtccgtgga gggctggatc gtgctcgtca ccggcgtgca cgaggaggcc       120
     caggaggacg acctgcacga gcacttcgcc gactacggcg agatccgaaa catgcacctc       180
     aacctggacc gacggacggg gttcgtcaag gggtacgcgc tgatcgagta cgagacgaag       240
     aaggaggccc aggccgcgat cgacggcgcg aacggatcga gcatgctgga ccagaccctc       300
     gaggtgagct tcgcattctc caaggggccg atcaacaagt ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page