(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE23

MICSR_1.PE23         Location/Qualifiers
FT   CDS_pept        complement(40580..41458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636028"
FT                   /orf_name="MICPUN_80078"
FT                   /product="Glycosyltransferase family 7 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62040.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="UniParc:UPI000199AAB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q0"
FT                   /transl_table=1
FT                   /translation="MLPQSINSLIGAAAANFATKGGSATLHHTVVPGDASVVWQREVLG
FT                   VCVPYRDRRDQLEVFASHLRTFLHGQGVPFRIYVGEQMAGGSFNRGWALNVAYKFAEPE
FT                   VDYVVFHDVDMLPLPGVDYRYSSMEGMDARHLSTEISQFGYKIPYNRYCSGVFMSRKEF
FT                   FRDINGFATTFWGWGGEDDEFCARWAKKKFGGWEAAEAAPGGLHNMFGRPEKGRGRFLS
FT                   MEAGHKSDRKNPHWKKNDQKLQSFLSSPETVNKADGLSTTGEPTQILKGKVETPLYTVY
FT                   RSSFPPNLRQP"
     atgctgccgc agagcatcaa ctcgctcatc ggcgccgccg ccgcaaactt cgccaccaag        60
     gggggaagcg ccacgcttca ccacacggtg gtgcccggtg acgcgtccgt ggtgtggcag       120
     cgggaggtgc tcggagtgtg cgtaccgtac cgggatagga gggatcagct cgaggttttc       180
     gcgtcgcacc tgcgaacgtt tctccacggg caaggcgtcc ctttcaggat atacgtaggc       240
     gaacagatgg cgggcgggtc tttcaaccgc ggctgggccc tgaacgtggc gtataagttc       300
     gccgagcccg aggttgacta cgtggtgttc cacgacgtgg acatgctccc gctgccgggc       360
     gtcgactaca ggtacagctc catggagggg atggacgcca ggcacctgtc cacggagatt       420
     tcccagtttg gatacaagat accctacaac aggtactgca gcggggtgtt catgtccagg       480
     aaggaattct tcagggacat caacgggttc gcgaccacgt tctggggatg gggcggcgag       540
     gacgacgagt tctgcgcgcg ctgggccaag aaaaagtttg gcgggtggga ggcggcggag       600
     gcggcgccgg gcggtttgca caacatgttt ggacgaccgg agaagggccg aggtcggttc       660
     ctgtccatgg aggctgggca caagagcgac aggaagaacc cgcactggaa gaagaacgat       720
     cagaagctgc agtcgttcct cagctccccg gagacggtca acaaggcgga cgggctcagc       780
     acgaccgggg agccgacgca gatactgaag ggcaaggttg aaacgccgct ttacacggtg       840
     tatagaagtt cgttcccgcc aaacctcagg cagccgtaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page