(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE230

MICSR_1.PE230        Location/Qualifiers
FT   CDS_pept        join(complement(461189..461536),complement(459947..461014))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636570"
FT                   /orf_name="MICPUN_105261"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62138.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AB3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A7"
FT                   /transl_table=1
FT                   /translation="MVEVGAPGAAAHAVAFCRACTCAFPVVLLVFLAAFTSLPGRYDSH
FT                   VVVRSYAGYLPVVKDEPAVFGPRVPADGVTARLEEASPKEACEALTNKYEGRWIALVQR
FT                   SFGTEKCDFVTKVRNAEMAGAVAVVVFDNVDGPLIPMAKKNEDNDVNVPSVFVSKESGE
FT                   ALETLLNDPKHGKTVVVTLESPDSPFDDWPNVATSACVTFGALCVLLSVVLVLKRREQA
FT                   HLAAMAAQRPPETRLLSAEEVAAVAKTAVFSSQERVLSFLRGATCGGAHASAGDGDGED
FT                   DKLVVDNGTGDTCAVCIEDYESGDELRALDCGHAFHKDCIDPWLITKRACCPVCKHVIA
FT                   PPPPPENVPDSRRRRRSRWSVLSNASVATVGGAESADESDLEAPLLPASSPARSLRRGV
FT                   MRWLTRRTAAGHPDASPAVSPDSDADDSDPGGVDDGGDESTGPGGGEEGPAGGDLEAGE
FT                   ARAGGADGTDGEQ"
     atggtcgagg tgggagcgcc gggcgcggcc gcgcacgccg tggcgttctg ccgcgcgtgc        60
     acctgcgcgt tccccgtggt cctcctcgtc ttcctcgccg cgttcacctc cctgcccggg       120
     cgctacgact cgcacgtcgt cgtccggagc tacgccgggt acctgcccgt ggtgaaggac       180
     gagcccgccg tgttcgggcc gcgcgtgccc gcggacggcg tgaccgcgcg gctcgaggag       240
     gcgtcgccga aagaggcgtg cgaggccctg acgaataagt acgaggggcg gtggatagcc       300
     ctcgtgcagc gctccttcgg aacggagaag tgcgacttcg tcaccaaggt gagaaacgcg       360
     gagatggcgg gcgccgtcgc ggtcgtcgtc ttcgacaacg tcgacggccc gctgataccc       420
     atggcgaaaa agaacgagga caacgacgtg aacgttccat ccgtcttcgt ctccaaagaa       480
     tcaggcgagg cgctggagac tttactgaac gacccgaagc acggcaagac ggtggtggtc       540
     accctggaat cgccggactc gccgttcgac gactggccga acgtggcgac cagcgcgtgc       600
     gtcaccttcg gcgccctgtg cgtcctgctc tccgtcgtcc tcgtgttaaa gcggagggag       660
     caggcgcacc tcgcggcgat ggctgcgcaa aggccgccgg agacgcggct gctcagcgcg       720
     gaggaggtgg ccgccgtggc caagaccgcg gtgttctcca gccaagagcg cgtgctgagc       780
     ttcctgcgcg gggctacctg cggcggggca catgcatccg cgggggatgg agacggcgag       840
     gacgataagc tcgtggtgga caacggcacc ggcgacacgt gcgcggtgtg catcgaggat       900
     tacgagagcg gcgacgagct ccgagcgttg gactgcggcc acgcgttcca caaggactgc       960
     atcgacccct ggctcatcac caagcgcgcg tgctgccccg tgtgtaagca cgtcatcgcg      1020
     ccgcccccgc cgccggagaa cgttccggac agtcggcggc gcaggcggag caggtggtcg      1080
     gtgctgagca acgcatcggt ggcgacggta ggcggggcgg aatcggcgga cgagtcggac      1140
     ctcgaggcgc ccctgctgcc cgcctcgtct ccggcccggt cgttgcggcg gggtgtgatg      1200
     cgatggctga cgcggcggac ggccgccggt catccggacg cgtcgccagc tgtgtctccc      1260
     gactcggacg ccgacgattc agacccgggg ggggtcgacg acggaggcga cgaatcgacg      1320
     ggacccggcg ggggtgagga agggccggcg ggaggggact tggaggctgg cgaggcgcgg      1380
     gcgggtggcg cggatggaac ggacggggag cagtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page