(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE232

MICSR_1.PE232        Location/Qualifiers
FT   CDS_pept        join(complement(462554..>463203),
FT                   complement(<462361..462445))
FT                   /codon_start=1
FT                   /gene_family="HOG000265856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636572"
FT                   /orf_name="MICPUN_70927"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62139.1"
FT                   /db_xref="HOGENOM:HBG635664"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="UniParc:UPI000199AB3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A9"
FT                   /transl_table=1
FT                   /translation="KPAVVVLPGLGNCTEDYDEFASELELRGFSATVAAVGRPDWLRNA
FT                   AGLTQLAYWQGTLEPRPTVDWYLSRIADAVAAAKEKSGADRVALVAHSAGGWMSRVYMQ
FT                   DFGVDDIRCVVTLGSPLNAVPKDVPGVVDQTRGILTYVEANCAKPTELGVPVTCLAGKW
FT                   LLGVETLGGAGDAAGFLVGQGYKQVCGSAAAWGDGITPVATAHLDGADNVTLEGVFHTP
FT                   IGSSDERPWYGTPKVLDQWVDKL"
     aagcccgcgg tcgtcgtcct cccgggcctg ggcaactgca ccgaggacta cgacgagttc        60
     gcgagcgagc tggagcttcg cggcttctcc gccaccgtcg ccgccgtcgg ccgccccgac       120
     tggctccgca acgccgcggg tctcacgcag ctggcgtact ggcagggtac cctcgaaccg       180
     cggcccacgg tggactggta cctctcccgc atcgccgacg ccgtcgccgc ggcgaaggag       240
     aagagcggag ccgatcgcgt ggcgctcgtg gcgcacagcg cggggggttg gatgagccgc       300
     gtgtacatgc aggacttcgg cgtcgacgac atcaggtgcg tcgtgacgct cgggtcgccg       360
     ctcaatgcgg tgcccaagga tgtccccggg gtcgtggacc agacccgcgg catcctcacc       420
     tacgtcgagg ccaactgcgc caagcccacg gagctcggcg tgccggtgac gtgcctggcg       480
     ggcaagtggc tcctgggcgt ggagacgttg gggggcgccg gggacgccgc ggggttcctc       540
     gtcgggcagg ggtataagca ggtgtgcggg tccgcggcgg cgtgggggga cgggatcacg       600
     ccggtggcga cggcgcacct ggacggcgcg gacaacgtca cgctcgaggg ggtattccac       660
     acgccgatag ggtcgtcaga cgagcggccg tggtacggca ccccaaaggt gctcgaccag       720
     tgggtggaca agctg                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page