(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE233

MICSR_1.PE233        Location/Qualifiers
FT   CDS_pept        complement(<464529..465057)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636573"
FT                   /orf_name="MICPUN_79707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62140.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B0"
FT                   /transl_table=1
FT                   /translation="MRTKLTVLPAAVARLSGLRTLILSDNSLTSLPAEIGELSQLRVLE
FT                   AERNQIASIPDEIANCKNLENIRVGYNKITDLSALADCDNLVTLVVDGNALDSLESLNL
FT                   REKQRLVTLSAKKNGIESVPADLGKCQLLAEIFLNDNKIGDLPMSMGELKEKKVRAIEL
FT                   DGNPLNDPKVKKM"
     atgcgcacca agctcacggt cctgcccgcc gccgtcgcga ggctctccgg cctcagaacg        60
     ctcatcctca gcgacaactc gctgacctcg ctgccggctg agattggcga gctgtcgcag       120
     ctgagggttc tcgaggcaga acggaaccag atcgcgtcga ttcccgacga gatcgccaac       180
     tgcaagaacc tggagaacat tcgcgtcgga tacaacaaga taaccgacct ttcggcgctc       240
     gcggactgcg ataacctcgt cactctggtt gtcgacggca acgcgctaga ctctctggag       300
     tctcttaacc tgcgggaaaa acagcggctg gtgaccctca gcgccaagaa gaacggcatc       360
     gagtccgtgc ccgcggacct cggcaagtgc cagcttctcg ccgagatctt cctcaacgac       420
     aacaagatcg gcgacctccc gatgtccatg ggggagctca aggagaagaa ggtgcgcgcc       480
     atcgagctgg acggcaaccc gctcaacgac ccgaaggtga agaagatga                   529
//

If you have problems or comments...

PBIL Back to PBIL home page