(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE234

MICSR_1.PE234        Location/Qualifiers
FT   CDS_pept        join(466161..466238,466379..466948)
FT                   /codon_start=1
FT                   /gene_family="HOG000243523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636574"
FT                   /orf_name="MICPUN_90229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61706.1"
FT                   /db_xref="HOGENOM:HBG560076"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniParc:UPI000199AB41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B1"
FT                   /transl_table=1
FT                   /translation="MALCMSTSASVAKVARPAVRASAEEKPASVPRRVTNALAAAALSA
FT                   SIALAGPVSSANAEIRLPPLDPDPERCERAFVGNTIGQANAVSDRILDLRQCNYVDKDL
FT                   STKTLSGALMVDATFKGANMTEVVMSKAYAVNADFTGANFTNAVVDRVTFDGANLSNAN
FT                   FFNAVITGATFEGTNLAGAQFDEALIGKEDVKKLCENPTLVEETRFQVGCRN"
     atggccctct gcatgtccac ctcggcgtcc gtcgccaagg ttgcccgccc cgcggttcgc        60
     gcctccgctg aggagaagcc cgcgtcggtg cccaggcgcg tcaccaacgc actcgccgcc       120
     gcggctctca gcgcctccat cgcgctcgcc ggtcccgtct ccagcgccaa cgcggagatc       180
     cgcctgcccc cgctcgaccc cgatcccgag cggtgcgaac gcgcgttcgt ggggaacacc       240
     atcgggcagg ccaacgcggt gagcgaccgc atcctggacc tccgccagtg caactacgtg       300
     gacaaggacc tgtcgaccaa gactctctcc ggcgcgctca tggtggacgc gaccttcaag       360
     ggcgcgaaca tgaccgaggt ggtcatgtcc aaggcgtacg cggtgaatgc cgactttacc       420
     ggcgcaaact tcacaaacgc cgtggtggac agggtgacgt tcgacggcgc taacctctcg       480
     aacgccaact ttttcaacgc ggtcatcacc ggcgccacct tcgagggcac caacctcgcg       540
     ggggcgcagt tcgatgaggc gctcatcggc aaggaggacg tcaagaagct ctgcgagaac       600
     ccgacgctcg tggaggagac caggttccag gttgggtgca ggaactga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page