(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE235

MICSR_1.PE235        Location/Qualifiers
FT   CDS_pept        complement(467081..468481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636575"
FT                   /orf_name="MICPUN_56808"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62141.1"
FT                   /db_xref="UniParc:UPI000199AB42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B2"
FT                   /transl_table=1
FT                   /translation="MAAQIRAATATGIAHARRRRMPSRCARAFRAAASGSISGARSESD
FT                   ERTDAVRARLMRELARGRTGSVPRVMGPIVSEPRPDDGVVIDRLTLAPESRNEGLEHAV
FT                   PVAVVRPHGDWDDALPVVAFLHGTGGDTEGLMPQLMSIAARGYVAVGVDAPCHGRRLEP
FT                   GSAAHVADGDDDERSHHPSKSSAGAPAAEGLGHGSGNSRERTFERYGAALVAAWRRGNI
FT                   EGENGTGSGGNEGSRRGDARPFLFDGAWDALRALRFVTRGDEYGDLTDPSRVGIGGISL
FT                   GGMYAWLAGAADPGLVTGAVAPIVGVQHFAWGLLNDSWRARADSLPPALFAAAAEELVG
FT                   DPSAVDAGIVGAVYRRICPGLIDELDGPATLPLISPRPLLVVNGELDPRCPFPGLMNAV
FT                   TETRAAYASVGKTSLFRTLVQRRTPHRCTPEMVDVVNRWFDETLRPARPDVALPTRGHL
FT                   DPNTWIEL"
     atggcggcgc agatccgagc ggccacggcg acgggcatcg cacacgcgcg acgcaggcgg        60
     atgccatcga gatgtgctcg cgcgttcaga gccgccgcgt cgggttccat cagcggggcg       120
     cgatccgagt ccgacgagag gacagatgcg gttcgcgcgc gattgatgcg cgaactcgcg       180
     cggggccgaa ccgggtcggt cccacgcgtg atgggtccga tcgtctcgga gccccggccg       240
     gacgacggcg tcgtcatcga tcgcctcacg ctcgcgccgg agtcccggaa cgaggggttg       300
     gagcacgccg tgccggtcgc ggtcgtcagg ccccacgggg actgggacga cgcgctcccg       360
     gtcgtcgcgt tcctgcacgg caccggcggt gacaccgagg gcttgatgcc gcaattgatg       420
     tcgatcgccg cgcgcgggta cgtcgccgtc ggagtggacg cgccctgcca cggcaggcgc       480
     ctcgaaccgg ggtccgccgc gcatgttgcc gacggggacg acgacgagcg gagtcaccat       540
     ccgtcgaagt catccgcggg ggcgccggcg gctgaggggc tggggcacgg ctccggaaac       600
     tcgcgcgagc gcacgttcga gcggtacggc gccgcgctcg tcgccgcgtg gcggcgcggg       660
     aacatcgagg gcgagaacgg gacgggaagc ggggggaacg aagggagtcg ccggggcgac       720
     gctcggccgt ttttgtttga cggcgcgtgg gacgcgctca gagcgcttcg gttcgtgacg       780
     cgaggcgacg agtacggcga tctgaccgat ccctccaggg tcgggatcgg gggtatatcg       840
     ctcgggggca tgtacgcgtg gctggcgggc gcggcggacc cggggctggt caccggcgcg       900
     gtcgccccca tcgtcggcgt tcagcacttt gcgtggggtt tgctgaacga ttcttggagg       960
     gcgagggcgg attcgctccc gcccgcgctg ttcgccgccg cggccgagga gctcgtgggg      1020
     gatccgtccg cggtggacgc ggggatcgtc ggggcggtgt accgcaggat atgcccgggt      1080
     ctcatcgacg agctggacgg cccggcgact ctgccgttga tctcgccccg accgctcttg      1140
     gtcgtcaacg gcgagctcga ccctcggtgc cctttccccg gactgatgaa cgccgtgacc      1200
     gagaccaggg cggcgtacgc ttccgtcggt aagacgtcgc tgtttcggac cctggttcag      1260
     aggcggacgc cgcaccggtg cacgcccgag atggtggacg tcgtgaaccg atggttcgac      1320
     gagacccttc ggcccgcgag gcccgacgtc gcgctgccca ctcgcggaca cctggacccg      1380
     aacacgtgga tcgagctctg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page