(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE236

MICSR_1.PE236        Location/Qualifiers
FT   CDS_pept        468580..469839
FT                   /codon_start=1
FT                   /gene_family="HOG000251397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636576"
FT                   /orf_name="MICPUN_56809"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61707.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG527018"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B3"
FT                   /transl_table=1
FT                   /translation="MADRKYDIVLFGVTGFTGKLACEHLLSKGYPVRWAVCARTEAKAR
FT                   SVLASIASRLGVPDDVLPPILVADLQPSNSDPEHARLRGVVRDAAVVITAAGPFEKYGE
FT                   HLVRMCAEEGTHYADTTGESDFFRRCIDLHDATARATGATIVSHCGNDCVPWDLAVLAA
FT                   AELARDRFGPRTTLSAASTFTELPPGVGASGGTLATAIYQLGKKRGGSRTAFDPLLRLP
FT                   DGSKSKEATKVRSPKSDVYYEEFGAYAGPWIMQPVMGNCVRRSNALLGYNAGEEFAYSE
FT                   AQLRHPSFIRWIADSSYNALIGAAIYVPPLCALLPAPGEGPSREEMIAGYLKLHLRAEG
FT                   KAPDGKKFKVKGLMTFDEDTGYLCTGRMLAESGMELLEAAKAGGEKKAGVLTPATAMGT
FT                   SLLRRMERELPMKWEVEIAD"
     atggccgacc gcaagtacga catcgtcctc ttcggagtca ccggcttcac gggaaagctc        60
     gcgtgcgagc acctcctctc caagggatac cccgtcaggt gggcggtatg cgcgcgcacg       120
     gaggcgaagg cccggtccgt gctcgcgtcg attgcgagtc gcctcggcgt ccccgacgac       180
     gtcctgcccc cgatcttggt cgccgacctc caaccctcga actcggaccc ggaacacgcc       240
     agactccgcg gcgtggtgcg cgacgccgcc gtggtcatca ccgcggccgg gcccttcgag       300
     aagtacggcg aacatctggt gaggatgtgc gcggaggagg ggacgcacta cgcggacacc       360
     acgggcgagt cggacttttt caggcgctgc atcgacctcc acgacgccac cgcgagggcc       420
     accggcgcga cgatcgtgtc gcactgcggc aacgactgcg tcccgtggga cctcgcggtc       480
     ctcgccgcgg cggagctggc gcgcgatcga ttcggtccgc gaacgacgct ctccgccgcc       540
     tccacgttca cggagcttcc accgggcgtg ggcgcgtcgg gaggcaccct cgccacggcc       600
     atctatcagc tgggtaagaa acgcggggga tcgaggaccg cgttcgaccc gctgctcagg       660
     cttccggacg ggtccaaatc gaaagaggcg accaaggtga gatcgccaaa gtcggacgtg       720
     tactacgaag agttcggcgc gtacgccggg ccttggatca tgcaaccggt gatgggcaac       780
     tgcgttcgac ggtccaacgc gttgctcgga tacaacgccg gcgaggagtt cgcgtacagc       840
     gaggcgcagc tgcggcatcc ttctttcatc cgttggatcg ccgattcgtc gtacaacgcg       900
     ctcatcggag ccgccatcta cgtcccgccg ctttgcgcgc tcctccccgc ccccggagaa       960
     ggcccctcgc gcgaggagat gattgcgggg tacctgaagc tgcacctgcg ggcggaagga      1020
     aaggcgcccg acgggaagaa attcaaggtg aaggggctga tgaccttcga cgaagacacc      1080
     gggtacttgt gcaccggacg catgctcgca gagagcggca tggagctgtt ggaggcggcc      1140
     aaggcgggag gggagaagaa ggcgggcgtg ttgaccccgg cgacggcgat ggggaccagc      1200
     ctactgcgcc gcatggagag ggagctgccc atgaagtggg aggtggagat tgcagattga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page