(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE237

MICSR_1.PE237        Location/Qualifiers
FT   CDS_pept        complement(<470440..>471108)
FT                   /codon_start=1
FT                   /gene_family="HOG000200794" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636577"
FT                   /orf_name="MICPUN_69262"
FT                   /product="Cytochrome oxidase biogenesis family "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62142.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG317219"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000199AB44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B4"
FT                   /transl_table=1
FT                   /translation="HLAHDMEWWAAIMATTAIMRVFVMPFMVMQQRVAARMHIAKPEIE
FT                   ALNARIKGMGGDQQVMAEAQKEIFAIWKKHNCNPAYMMLPIAVQAPLFISFYFAISEMA
FT                   KGVPSFASGGPDWPLGPISMHDLTAADPTYIMPVLSSATFLATVELGGAGNPETSGAAQ
FT                   QTMMTKWGLRALSVALIPMTAGFSKGVFVYWITTNMFSLGQTLAFKVPLIKKIVAIPEI
FT                   P"
     cacttggcgc acgacatgga gtggtgggcc gccatcatgg ccacgaccgc cattatgcgt        60
     gtctttgtca tgcccttcat ggtcatgcag cagcgcgtgg cggccaggat gcacatcgcc       120
     aaacccgaga ttgaggcgct gaacgcgcga atcaagggca tgggcgggga ccagcaggtg       180
     atggcagaag cacagaagga gatattcgcg atttggaaga agcacaactg caatccggcg       240
     tacatgatgc tgcccatcgc ggtgcaggcg ccgcttttca tctccttcta tttcgcgata       300
     tcggagatgg cgaagggggt gccgtcgttt gcatctggcg gcccggactg gccgctcggg       360
     ccaatctcga tgcacgatct gaccgccgcg gaccccacgt acatcatgcc cgtgctctcg       420
     tccgcgacgt tcctcgctac ggtcgagctg gggggcgcgg gcaacccgga aacctccggg       480
     gccgcgcagc agacgatgat gaccaagtgg ggtctcaggg cgctctccgt ggctctcatt       540
     ccgatgacgg ctgggtttag caagggcgtg tttgtgtact ggatcaccac gaacatgttc       600
     tcgctaggcc agacgctcgc gttcaaagtt ccgttgataa agaagatcgt cgcgatcccg       660
     gagattccg                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page