(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE238

MICSR_1.PE238        Location/Qualifiers
FT   CDS_pept        complement(471802..474087)
FT                   /codon_start=1
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636578"
FT                   /orf_name="MICPUN_80021"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62143.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199ABB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B5"
FT                   /transl_table=1
FT                   /translation="MSLANLARASSGPGASVRRPATVQRHAASLSGTAPAKASASKIWR
FT                   RRAPVLLGARAASRDDAGPTGTSPTSSVAGSNDATGAAAASDARIPTYHLHEEEHDFDV
FT                   IVVGAGHAGCEAALAASRRGARTLLLTLSLDRIAWQPCNPAVGGPAKSQLVHEVDALGG
FT                   EIGKMADKCYLQKRVLNASRGPAVWALRAQTDKWEYSREMRLRLERQPNLMIREGMATD
FT                   VLVGSNDEVAGVRTFFGMEFRAPAVVLTTGTFMSGQIWVGRKTLAAGRAGEAPSEGLTE
FT                   SLCDLGFETDRLKTGTPARVDSRSIDYSLLEAQPGDEDERWFSFDPRAHVAREQMACHL
FT                   TRTTAATHQLIRDNLHETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRS
FT                   CPEVYVQGFSTGLPERLQLALLRTLPGLEKVNMLRPAYAVEYDFLPAYQCDNTLETKKI
FT                   RGLFFSGQINGTTGYEEAAAQGLLAGANAAAVALDGAKLVLPREGSYLGTLIDDLCTKD
FT                   LREPYRMLTSRSEYRLVLRSDNADQRLTPIGRECGLIDDERWGMFTDKMHAVEDELERL
FT                   KNTRVKSDSEVVQAILNAGAGGAKKPSRQSFTLEELLRRPEVDTAMLDGFGLGGGLTRW
FT                   DAEAVEVKVKYEGFIKRQEGQVAKVAGKMNKKIPEGIDYGAITTLRMEAREKLAKMTPR
FT                   TVGQASRIGGVTPADISSLLVHLEVGNRQKGVGKDARRAAKADRKAAVEAAEKERSETQ
FT                   SQSVAPPR"
     atgtcgctcg cgaacctcgc acgcgcatcc tcgggacccg gggcgtcggt gcgtcgcccc        60
     gcgacggtcc aaagacacgc ggcgtcgctc tccggtacgg cgccggcgaa ggcgagcgcg       120
     tcaaaaatct ggcggcggcg ggcccccgtg cttctcggcg cgcgagccgc gtcgagggac       180
     gacgcgggtc cgaccggaac gtcgcccacg tcttccgtcg cagggtcaaa cgacgcgacc       240
     ggcgccgcgg cggcgtcgga cgcccgcatc cccacgtacc acctgcacga ggaggagcac       300
     gacttcgacg tcatcgtggt cggcgccggt cacgcgggtt gcgaagccgc gctcgccgcc       360
     tcccgccgcg gcgccaggac cctgctcctc accctatcgc tcgatcgcat cgcgtggcag       420
     ccgtgtaacc ccgcggtggg aggacccgcg aagtcgcagc tggtgcacga ggtggacgcg       480
     ctcgggggag agatcgggaa gatggcggat aagtgctacc tccagaagag ggtgctcaac       540
     gccagcagag gacccgcggt gtgggcgctc cgggcgcaga cggacaagtg ggaatactcg       600
     cgcgagatgc gtctgcgtct ggagcgccag ccaaacctga tgatccgcga gggcatggcc       660
     acggacgtct tggtgggttc caacgacgag gtggccgggg tgcgaacgtt cttcgggatg       720
     gagtttcgcg cgccagctgt ggtgctcacc accgggacgt tcatgtcggg gcagatatgg       780
     gtcggtcgca aaaccctagc cgccggacgc gccggggagg caccctccga gggcctcacc       840
     gagagcctat gcgacctggg gttcgagacg gaccggctca agacggggac gcccgcgcga       900
     gtggacagcc gaagcataga ctactccctg ctcgaggcgc aacccgggga tgaggacgag       960
     cggtggttct cgttcgaccc gagggcgcac gtcgcacggg agcagatggc gtgccacctg      1020
     acgcgcacca ccgccgcgac gcaccagctc atccgagata acctgcacga gacgcccacc      1080
     tacggcggtt gggtgggcgc caagggaccg cgatactgcc cgtccatcga ggacaaaatc      1140
     gttcgcttcg cggataaaga atcgcaccaa atcttcctcg aacccgaggg gcgatcgtgc      1200
     ccggaggttt acgtgcaggg attcagcacc gggctgcccg agcgcttgca gctggcgctg      1260
     ttgaggacgc ttccaggtct ggagaaggtt aacatgctga ggcccgcgta cgccgtcgag      1320
     tacgattttc tcccggcgta ccagtgcgac aacacgctgg agacgaagaa gatccgcggt      1380
     ctcttcttct ccgggcagat caacggcacc acggggtacg aggaggccgc ggcgcagggg      1440
     ctgctcgcgg gtgccaacgc cgcggccgtg gcgctcgacg gcgcgaagct ggtgctgccc      1500
     agggagggga gctacctcgg aacgctcatc gacgacctct gcaccaagga cctgcgcgag      1560
     ccgtaccgca tgctgacgag ccgatcagag taccggctcg tgctcaggtc cgacaacgcg      1620
     gaccagcggc tcaccccgat cggtcgcgag tgcggcctga tcgacgacga gcggtgggga      1680
     atgttcactg acaagatgca cgcggtggag gacgagctcg aacgactgaa gaacacgagg      1740
     gttaagagcg actcggaggt tgtccaggcc atactcaacg ccggcgcggg cggggcgaag      1800
     aagccgagca ggcagtcttt cacgctggag gagctcctgc gccgccccga ggtggacacc      1860
     gcgatgctgg acgggtttgg gctcgggggc ggtttgaccc gatgggacgc ggaggctgtc      1920
     gaggtcaagg tcaagtacga gggtttcatc aagcgacagg aggggcaggt ggccaaggtg      1980
     gccggtaaga tgaacaagaa gatccccgag ggcatagact acggcgccat caccacgttg      2040
     cgcatggagg cgagggagaa gctggcgaag atgacgccgc ggaccgtggg gcaggcaagc      2100
     aggatagggg gcgtgacccc cgccgatatc tcgtcgctgc tggtgcacct ggaggttgga      2160
     aacaggcaga agggagtcgg gaaggacgcc aggcgcgcgg ccaaggcgga taggaaagct      2220
     gcggtcgagg cggcggagaa ggagcggtcg gagacgcaga gccagtccgt ggctcctcct      2280
     cgatag                                                                 2286
//

If you have problems or comments...

PBIL Back to PBIL home page