(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE240

MICSR_1.PE240        Location/Qualifiers
FT   CDS_pept        join(complement(476028..477390),complement(475970..475986))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636580"
FT                   /orf_name="MICPUN_56812"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62144.1"
FT                   /db_xref="HOGENOM:HBG560079"
FT                   /db_xref="UniParc:UPI000199ABB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B7"
FT                   /transl_table=1
FT                   /translation="MPPSRRSKGIRGWSLVIFVLAANVAYQGTRYLWRPTTGATPVSGH
FT                   QREKLEIRHRDDRRGGALLHHGHGASHGHGFHDAGVHRNDDDVEVIEEVVYEDVVVEDE
FT                   GHHGSSRGGASSGGGEGGGDPEPSGIHVMATSNGSPYQNWQTRIMYRTFLDAAKGSDMK
FT                   HFTRLLHRRTDDELMAEVPTVRVDSLHAECDRWCEFPVADRPDAIKKWLATADSRRGEW
FT                   ILMIEMDYVWKKAVPMPEPGSPAVAFHFNYINPNYPRLPEVMRSLMPPEKRDEIKMEDI
FT                   PCTGPAPTMIRRDDLVPLMDEYERIAAAIEADPVAKNRLGWVREMYAYDLAAAIAGVIH
FT                   VVQDPGETIMIAQPPADAKMGRASMYHYTWGAEYFKNGAKVWSWDKRPYVETKHVRQPA
FT                   KFKPELPPADGSEGVYNLQDGKKVSKGTDELLRDMLTLIRGAIDRLDELPHQPGCARKA
FT                   L"
     atgccgcctt cccgtcgcag caagggaatc cggggctggt ccctcgtcat cttcgtgctc        60
     gcggcgaacg tcgcgtacca gggaacccgg tacctctggc gaccgacgac gggagctacg       120
     cccgtgtcgg ggcaccagcg cgagaagctc gagatccgtc atcgggacga tcgtcgcgga       180
     ggcgcgcttc tccaccacgg tcacggcgcg agccacggcc acgggtttca cgacgccggg       240
     gttcatcgca acgacgatga tgtcgaggtc atcgaggagg tggtgtacga ggatgttgtg       300
     gtcgaggacg aggggcacca cgggtcatcg cgcggggggg catcgtcggg ggggggcgag       360
     gggggcgggg atcccgagcc gtccgggata cacgtcatgg ccacgtccaa cgggagcccg       420
     taccagaact ggcagacccg gatcatgtac cgcaccttcc tcgatgcggc aaagggcagc       480
     gacatgaagc acttcaccag gcttctgcac aggcgcacgg acgacgagct catggcggag       540
     gtgcccacgg tgcgagtcga ctcgctgcac gcggagtgcg acaggtggtg cgagttcccc       600
     gtcgcggaca ggccggacgc catcaagaag tggctcgcga ccgccgacag ccgacgtggg       660
     gagtggattc tcatgatcga gatggactac gtctggaaga aggcggtgcc gatgccggag       720
     cccgggtcgc cagccgtggc gtttcacttc aactacatca acccgaacta cccgaggctg       780
     ccggaggtga tgaggagcct gatgccgccg gagaaaaggg acgagataaa gatggaggac       840
     ataccttgca ccggacccgc gccgacgatg atccgcaggg acgacctcgt cccgctcatg       900
     gacgagtacg agcgcatcgc cgcggccatc gaggcggatc cggtggcgaa aaacaggctc       960
     gggtgggtcc gcgagatgta cgcgtacgac ttggcggcgg caatcgccgg ggtcatacac      1020
     gtggtgcagg atccgggaga gacgatcatg atcgcgcagc cccccgcgga cgccaagatg      1080
     ggcagggctt cgatgtacca ctacacctgg ggggcggagt atttcaagaa cggggcaaag      1140
     gtttggtcgt gggacaagag gccttacgtc gagaccaaac acgtgcgaca gccggccaag      1200
     ttcaaacccg agttgccccc cgcggacggc tccgaggggg tgtataacct tcaggacggt      1260
     aaaaaggtgt cgaagggaac ggacgagctg ctgagagaca tgttgacgct gataagaggg      1320
     gccatcgaca ggctggacga gttgccacac caaccggggt gcgcccggaa agctctgtga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page