(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE241

MICSR_1.PE241        Location/Qualifiers
FT   CDS_pept        join(complement(489271..489355),complement(485735..489198))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636581"
FT                   /orf_name="MICPUN_56814"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62145.1"
FT                   /db_xref="UniParc:UPI000199ABB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B8"
FT                   /transl_table=1
FT                   /translation="MKGPPLPHVRDWLGAQSLYLFGVWATIVGIQSGSSQSVIRTLNVR
FT                   DSSAIGTPTATTVGSEGARMLVRAGRRVSRESGGVIRPWLAPWFSASDSVRSGGGARVD
FT                   AAGAAGSIRPGAGDGFLGGPTTGTIAGPILATISPRSFWRSALEALERAIEPSATPTPG
FT                   TPVTVSDDAQRDDSHDATDAVSADASDDFLAHLPNRKSRYESDARWPRPLSAHPKVEEL
FT                   LKRKGLFAKRTGSGAISSWWPKRIIKALRRCGEDRSQADRWNRDDVLWLLRNAKGHPRL
FT                   SSREETEKCWKDKSTVHEYIAMLSLFAGRGSPLALAKSMGSDEVMEAVRQVPLGWTGLA
FT                   FRDRSGHGPERVPFGPKELSTERWRKYEKDGTREMEEPTHRPVLTERLSYASRFRKNRK
FT                   VDINEATGDNLRAYRFRWWDATHLVAITRLWGTISRKHDFIPAPQAAVLGSYTHLALAA
FT                   DAAVALSRHIEIDDGIDDDGTRFVSDEKTNPPQTVFIRKLSEPFDQYTNRGTQDGVVKL
FT                   IQYGVRGWLDMATLWGPEEPWPNGFGVDHTRSGAPGADAASRQTFHAMVPPVELAAMTN
FT                   AFIHFAGLDPKLDKDQLSTWARLNSLWSRCTRASGTNWYYANLWYPGGQGKQHYPGTHL
FT                   TRNVGIDKRKGPVDVWDACAVTAHPSGKQVTVRKSRTLEALLGVTRETATAWQATDILC
FT                   GAADAYCFAYFGGYTYPAPMSALASHVLGVADHLGTLADAGALKPPDALRSLVSIAQFQ
FT                   QAMAMAGGETSGAAGTWLKIMDVVVEAAAADGLSPTELSRALLCWGKYLEARGVEKVDG
FT                   TVPLDPIADDEGDLRRLNALVDAFARSVTEATPEDLHGVAVALDRFIDRYSDNPHALAF
FT                   TDGGDSIRAIAREAAARIVPTMAREATRRKSAHELVKTIHRGFGRRLGELPQFRQRPLP
FT                   IEFKHAMNHARDQLALHAAATADACALQAYALRFLGEDASGTPPPAPEEFLARSSAVAA
FT                   AARDGLLPTIVLARAMRAWARVRAATAGGLIADEADVAAVHEALEASSSEGGLHEETVR
FT                   MLEEAEALFRQTIAIETNAGGGTGDDVEDEDPEVEVEVDEEQDEEQDEDHDANPDLSDD
FT                   AAIEFEAVKDDWLARLPKTKAAKLLEAIDACADDLEVMEAVAASAEEDATKVRAGARAR
FT                   VLEATAKLRVARSLFR"
     atgaagggcc ctccgctgcc ccacgttcgt gactggctgg gcgcgcagtc actttattta        60
     tttggggttt gggcaactat cgtcggcatt cagtcaggat ccagccagtc cgttatcaga       120
     acccttaacg tccgcgactc gtccgcgatc ggcaccccga ccgccacaac cgtcgggagc       180
     gagggcgccc gcatgctggt ccgtgcgggg cgacgcgtca gtcgcgagag cggcggggtg       240
     atccgtccct ggctcgcgcc ctggttctcc gcctccgact cggttcgcag cggcggcggc       300
     gcccgcgtcg atgccgccgg cgctgcagga tccattcgcc ccggggcggg cgacggcttc       360
     ctcggcgggc ccacgaccgg gaccatcgcg ggcccgatcc tggcgacgat ttccccgagg       420
     tcgttttgga ggagcgcgtt ggaggcgcta gaacgcgcca tcgaaccctc ggcgaccccg       480
     acgcccggga cgccagtcac cgtctccgac gatgcccaac gtgacgacag ccacgatgcg       540
     acggacgcgg tgtcggcgga cgcctcggac gatttcctcg ctcatttgcc caatcgcaaa       600
     agtcggtacg agtcagatgc gcggtggccg agaccactgt cggcgcaccc caaggttgaa       660
     gaactgctca agcgcaaggg cctcttcgcc aaacgtaccg gctccggcgc catctcgagc       720
     tggtggccga aacgaatcat caaggctctc agacggtgcg gagaggaccg cagtcaggcc       780
     gaccgatgga acagggacga cgtgttgtgg ctgctgcgga acgccaaggg ccatccgcgc       840
     ctgtcgtcga gggaagagac ggaaaagtgc tggaaggaca agagcacggt gcacgagtac       900
     atcgcgatgc tgtcactgtt tgccgggcgc gggtcgcccc tcgcgctcgc gaagagcatg       960
     ggatccgatg aagtgatgga agcggtgagg caggtgccgc tgggttggac cggcctcgcg      1020
     ttcagagatc gcagcggcca cggcccggag cgagtgccgt ttggtcccaa ggaattgtcc      1080
     acggaaagat ggcgcaagta tgaaaaagat ggcacaagag agatggagga gccgacgcac      1140
     cgcccggtgt tgaccgagcg cctgagctac gcctcgcgtt ttcggaaaaa taggaaggtc      1200
     gacatcaacg aggcgacggg cgacaacctg agggcgtaca ggttcaggtg gtgggacgcc      1260
     acccacttgg tggcgatcac gcggctgtgg ggaaccattt ccaggaaaca cgacttcatc      1320
     cccgcgccgc aggcggcggt cctaggctcg tacacccact tggccctcgc ggctgacgcc      1380
     gcagtggctc tgtcgcgcca catcgagatc gacgacggga ttgacgacga cgggactcgg      1440
     ttcgtctcgg atgaaaagac gaacccgcct cagacggtat tcatcaggaa gctctctgag      1500
     ccgtttgacc agtacaccaa ccgaggcacc caagatggcg tggtcaagct gattcagtac      1560
     ggcgtcaggg ggtggctcga catggccacg ctgtggggtc cggaagaacc ctggcccaac      1620
     gggttcggcg ttgaccatac gcgatctgga gccccgggcg ctgacgccgc gtcgaggcaa      1680
     accttccacg cgatggtccc gcccgtggag ctggcggcga tgacaaacgc gttcattcat      1740
     ttcgcgggcc tcgacccaaa actggacaag gatcagctgt cgacgtgggc gcggctcaac      1800
     tccctctggt cgcggtgcac ccgagcctcg ggcaccaact ggtactacgc caacctctgg      1860
     taccctggag gccaagggaa gcagcattat cccggcacgc atcttacacg gaacgtgggc      1920
     attgacaaaa gaaaaggccc cgtggacgtc tgggacgctt gcgccgtgac ggcgcacccg      1980
     tcgggtaagc aagtcactgt gcgaaagtct cgaacgctcg aggcgctgct gggcgtcacc      2040
     cgcgagacgg caaccgcgtg gcaggcgacc gatatcctct gtggggctgc cgacgcgtac      2100
     tgcttcgcgt actttggcgg ttacacttat cccgcgccga tgagtgcgct tgcatcgcac      2160
     gtcttgggag tcgccgatca cctcgggact ctcgcggacg ccggcgcgct gaaacctccc      2220
     gatgccctgc ggagtctcgt gtccatagcg cagttccaac aagcgatggc gatggccggc      2280
     ggggaaacgt cgggcgcggc ggggacgtgg ttgaaaataa tggacgtggt cgtcgaggct      2340
     gcagcggcgg atggcctgtc acccaccgaa ctctcccgcg cgctgctctg ctggggaaag      2400
     tacctggagg cccgcggggt ggagaaggtc gatggaacag ttcccctcga tcccatcgct      2460
     gacgacgagg gcgacctgag gcgcctgaac gcactcgtcg acgcgttcgc tcgttccgtt      2520
     acggaagcca ccccggagga ccttcacggc gtggcggttg cgttggaccg tttcatcgac      2580
     cgttacagcg acaaccccca cgccctggcg ttcaccgacg gcggcgactc catccgcgcg      2640
     atcgcccggg aggcggcggc gcggatcgtc ccgacgatgg cgagagaggc tacgcgacgg      2700
     aagtctgcgc acgagttggt gaaaaccatc caccgcgggt ttggtcgccg gctcggcgag      2760
     ttgccccagt ttcgccagcg acccttaccg attgagttca agcacgcgat gaaccacgcg      2820
     agggaccagc tggcgctcca cgccgccgcg accgccgacg cgtgcgcgct gcaggcttac      2880
     gccctgaggt tcctgggcga ggacgccagc gggaccccgc cgcccgcgcc cgaggagttt      2940
     ctcgctcggt cctcggcggt ggcggccgcg gcgcgggacg gtcttctgcc gacgatcgtc      3000
     ctcgcgaggg cgatgcgcgc gtgggctcgc gtgcgcgcgg cgacggcggg cgggttgatc      3060
     gcggacgagg cggacgtcgc ggcggtgcac gaggctctgg aggcgtcgtc gagcgagggt      3120
     ggtttgcacg aagagacggt gaggatgctc gaggaggcgg aggcgctttt ccgacagacg      3180
     attgcgattg agaccaacgc tggcggaggc accggggacg atgtcgagga cgaggatccc      3240
     gaggtcgagg tcgaggttga cgaggagcag gacgaggagc aggacgagga tcacgacgca      3300
     aacccagatc tatcagacga cgccgctatc gaatttgaag cggttaagga tgattggctc      3360
     gcgaggctgc caaagaccaa ggctgccaag ctgctcgagg cgatcgacgc ctgcgcggat      3420
     gacctagagg tgatggaggc ggtggctgca tcggcggagg aggacgccac caaggtgaga      3480
     gccggcgcga gggcgcgggt cctggaggcg acggcaaagc tccgagtcgc acggtccctg      3540
     ttccgatag                                                              3549
//

If you have problems or comments...

PBIL Back to PBIL home page